PDB entry 1kuh

View 1kuh on RCSB PDB site
Description: zinc protease from streptomyces caespitosus
Deposited on 1996-02-22, released 1997-03-12
The last revision prior to the SCOP 1.61 freeze date was dated 1997-03-12, with a file datestamp of 1997-03-13.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.164
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.61: d1kuh__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kuh_ (-)
    tvtvtydpsnapsfqqeianaaqiwnssvrnvqlraggnadfsyyegndsrgsyaqtdgh
    grgyifldyqqnqqydstrvtahetghvlglpdhyqgpcselmsgggpgpsctnpypnaq
    ersrvnalwang