PDB entry 1ktr

View 1ktr on RCSB PDB site
Description: crystal structure of the anti-his tag antibody 3d5 single-chain fragment (scfv) in complex with a oligohistidine peptide
Deposited on 2002-01-17, released 2002-05-15
The last revision prior to the SCOP 1.65 freeze date was dated 2002-05-15, with a file datestamp of 2002-05-15.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.19
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Domains in SCOP 1.65: d1ktrh_
  • Chain 'L':
    Domains in SCOP 1.65: d1ktrl_

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ktrH (H:)
    qvqlqqsgpedvkpgasvkisckasgytftdyymnwvkqspgkglewigdinpnnggtsy
    nqkfkgratltvdkssstaymelrsltsedssvyycesqsgaywgqgttvtvsa
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1ktrL (L:)
    dykdilmtqtpsslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvs
    nrfsgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpftfgsgtkleikr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ktrL (L:)
    dilmtqtpsslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpftfgsgtkleikr