PDB entry 1ktp

View 1ktp on RCSB PDB site
Description: Crystal structure of c-phycocyanin of synechococcus vulcanus at 1.6 angstroms
Deposited on 2002-01-17, released 2002-03-06
The last revision prior to the SCOP 1.65 freeze date was dated 2002-03-06, with a file datestamp of 2002-03-06.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.216
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1ktpa_
  • Chain 'B':
    Domains in SCOP 1.65: d1ktpb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ktpA (A:)
    mktpiteaiaaadtqgrflsntelqavdgrfkravasmeaaraltnnaqslidgaaqavy
    qkfpytttmqgsqyastpegkakcardigyylrmityclvaggtgpmdeyliaglseins
    tfdlspswyiealkyikanhgltgqaaveanayidyainals
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ktpB (B:)
    mldafakvvaqadargefltnaqfdalsnlvkegnkrldavnritsnastivanaaralf
    aeqpqliqpggnaytnrrmaaclrdmeiilryvtyailagdssvlddrclnglretyqal
    gtpgssvavaiqkmkdaaiaiandpngitpgdcsalmseiagyfdraaaava