PDB entry 1ktk

View 1ktk on RCSB PDB site
Description: Complex of Streptococcal pyrogenic enterotoxin C (SpeC) with a human T cell receptor beta chain (Vbeta2.1)
Class: immune system
Keywords: Streptococcus, immunity, T cell receptor beta, IMMUNE SYSTEM
Deposited on 2002-01-16, released 2002-06-07
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.326
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Exotoxin type C
    Species: Streptococcus pyogenes [TaxId:1314]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13380 (Start-207)
      • conflict (25)
    Domains in SCOPe 2.01: d1ktka1, d1ktka2
  • Chain 'B':
    Compound: Exotoxin type C
    Species: Streptococcus pyogenes [TaxId:1314]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13380
      • conflict (25)
    Domains in SCOPe 2.01: d1ktkb1, d1ktkb2
  • Chain 'C':
    Compound: Exotoxin type C
    Species: Streptococcus pyogenes [TaxId:1314]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13380 (0-207)
      • conflict (25)
    Domains in SCOPe 2.01: d1ktkc1, d1ktkc2
  • Chain 'D':
    Compound: Exotoxin type C
    Species: Streptococcus pyogenes [TaxId:1314]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13380 (Start-207)
      • conflict (25)
    Domains in SCOPe 2.01: d1ktkd1, d1ktkd2
  • Chain 'E':
    Compound: T-cell receptor beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01850 (0-246)
      • conflict (9)
      • conflict (12)
      • conflict (50)
      • insertion (96)
      • conflict (97)
      • conflict (100)
      • insertion (102-103)
      • conflict (105)
      • conflict (107)
      • conflict (191)
      • insertion (97)
      • conflict (98-99)
      • conflict (101)
      • insertion (103-104)
    Domains in SCOPe 2.01: d1ktke1, d1ktke2
  • Chain 'F':
    Compound: T-cell receptor beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01850
      • conflict (9)
      • conflict (12)
      • conflict (50)
      • conflict (107)
      • conflict (191)
    Domains in SCOPe 2.01: d1ktkf1, d1ktkf2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ktkA (A:)
    dskkdisnvksdllyaytitpydykdcrvnfstthtlnidtqkyrgkdyyissemsyeas
    qkfkrddhvdvfglfyilnshtgeyiyggitpaqnnkvnhkllgnlfisgesqqnlnnki
    ilekdivtfqeidfkirkylmdnykiydatspyvsgrieigtkdgkheqidlfdspnegt
    rsdifakykdnriinmknfshfdiylek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ktkA (A:)
    kkdisnvksdllyaytitpydykdcrvnfstthtlnidtqkyrgkdyyissemsyeasfk
    rddhvdvfglfyilnshtgeyiyggitpaqnnkvnhkllgnlfisesqqnlnnkiilekd
    ivtfqeidfkirkylmdnykiydatspyvsgrieigtkdgkheqidlfdspnegtrsdif
    akykdnriinmknfshfdiylek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ktkB (B:)
    dskkdisnvksdllyaytitpydykdcrvnfstthtlnidtqkyrgkdyyissemsyeas
    qkfkrddhvdvfglfyilnshtgeyiyggitpaqnnkvnhkllgnlfisgesqqnlnnki
    ilekdivtfqeidfkirkylmdnykiydatspyvsgrieigtkdgkheqidlfdspnegt
    rsdifakykdnriinmknfshfdiylek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ktkB (B:)
    kkdisnvksdllyaytitpydykdcrvnfstthtlnidtqkyrgkdyyissemsyeasqk
    fkrddhvdvfglfyilnshtgeyiyggitpaqnnkvnhkllgnlfiqnlnnkiilekdiv
    tfqeidfkirkylmdnykiydatspyvsgrieigtkdgkheqidlfdspnegtrsdifak
    ykdnriinmknfshfdiyle
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ktkC (C:)
    dskkdisnvksdllyaytitpydykdcrvnfstthtlnidtqkyrgkdyyissemsyeas
    qkfkrddhvdvfglfyilnshtgeyiyggitpaqnnkvnhkllgnlfisgesqqnlnnki
    ilekdivtfqeidfkirkylmdnykiydatspyvsgrieigtkdgkheqidlfdspnegt
    rsdifakykdnriinmknfshfdiylek
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ktkD (D:)
    dskkdisnvksdllyaytitpydykdcrvnfstthtlnidtqkyrgkdyyissemsyeas
    qkfkrddhvdvfglfyilnshtgeyiyggitpaqnnkvnhkllgnlfisgesqqnlnnki
    ilekdivtfqeidfkirkylmdnykiydatspyvsgrieigtkdgkheqidlfdspnegt
    rsdifakykdnriinmknfshfdiylek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ktkD (D:)
    kkdisnvksdllyaytitpydykdcrvnfstthtlnidtqkyrgkdyyissemsyeasqk
    fkrddhvdvfglfyilnshtgeyiyggitpaqnnkvnhkllgnlfisgesqlnnkiilek
    divtfqeidfkirkylnykiypyvsgrieigtkdgkheqidlfdspnegtrsdifakykd
    nriinmknfshfdiylek
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ktkE (E:)
    gavvsqhpsrviaksgtsvkiecrsldfqattmfwyrqfpkqslmlmatsaegskatyeq
    gvekdkflinhasltlstltvtsahpedssfyicsalagsgsstdtqyfgpgtrltvled
    lknfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqpl
    keqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsa
    eawgrad
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ktkF (F:)
    gavvsqhpsrviaksgtsvkiecrsldfqattmfwyrqfpkqslmlmatsaegskatyeq
    gvekdkflinhasltlstltvtsahpedssfyicsalagsgsstdtqyfgpgtrltvled
    lknfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqpl
    keqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsa
    eawgrad
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ktkF (F:)
    vsqhpsrviaksgtsvkiecrsldfqattmfwyrqfpkqslmlmatsaegskatgvekkf
    linhasltlstltvtsahpedssfyicyfgpgtrltvppevavfepvclatgfndsryal
    ssrlqnprnhfrvqfyvtqivsae