PDB entry 1ktk

View 1ktk on RCSB PDB site
Description:
Deposited on 2002-01-16, released 2002-06-07
The last revision prior to the SCOP 1.61 freeze date was dated 2002-06-07, with a file datestamp of 2002-06-07.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.326
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1ktka1, d1ktka2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1ktkb1, d1ktkb2
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1ktkc1, d1ktkc2
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1ktkd1, d1ktkd2
  • Chain 'E':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1ktke1, d1ktke2
  • Chain 'F':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1ktkf1, d1ktkf2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ktkA (A:)
    kkdisnvksdllyaytitpydykdcrvnfstthtlnidtqkyrgkdyyissemsyeasqk
    fkrddhvdvfglfyilnshtgeyiyggitpaqnnkvnhkllgnlfisgesqqnlnnkiil
    ekdivtfqeidfkirkylmdnykiydatspyvsgrieigtkdgkheqidlfdspnegtrs
    difakykdnriinmknfshfdiylek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ktkA (A:)
    kkdisnvksdllyaytitpydykdcrvnfstthtlnidtqkyrgkdyyissemsyeasfk
    rddhvdvfglfyilnshtgeyiyggitpaqnnkvnhkllgnlfisesqqnlnnkiilekd
    ivtfqeidfkirkylmdnykiydatspyvsgrieigtkdgkheqidlfdspnegtrsdif
    akykdnriinmknfshfdiylek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ktkB (B:)
    kkdisnvksdllyaytitpydykdcrvnfstthtlnidtqkyrgkdyyissemsyeasqk
    fkrddhvdvfglfyilnshtgeyiyggitpaqnnkvnhkllgnlfisgesqqnlnnkiil
    ekdivtfqeidfkirkylmdnykiydatspyvsgrieigtkdgkheqidlfdspnegtrs
    difakykdnriinmknfshfdiyle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ktkB (B:)
    kkdisnvksdllyaytitpydykdcrvnfstthtlnidtqkyrgkdyyissemsyeasqk
    fkrddhvdvfglfyilnshtgeyiyggitpaqnnkvnhkllgnlfiqnlnnkiilekdiv
    tfqeidfkirkylmdnykiydatspyvsgrieigtkdgkheqidlfdspnegtrsdifak
    ykdnriinmknfshfdiyle
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ktkC (C:)
    dskkdisnvksdllyaytitpydykdcrvnfstthtlnidtqkyrgkdyyissemsyeas
    qkfkrddhvdvfglfyilnshtgeyiyggitpaqnnkvnhkllgnlfisgesqqnlnnki
    ilekdivtfqeidfkirkylmdnykiydatspyvsgrieigtkdgkheqidlfdspnegt
    rsdifakykdnriinmknfshfdiylek
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ktkD (D:)
    kkdisnvksdllyaytitpydykdcrvnfstthtlnidtqkyrgkdyyissemsyeasqk
    fkrddhvdvfglfyilnshtgeyiyggitpaqnnkvnhkllgnlfisgesqqnlnnkiil
    ekdivtfqeidfkirkylmdnykiydatspyvsgrieigtkdgkheqidlfdspnegtrs
    difakykdnriinmknfshfdiylek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ktkD (D:)
    kkdisnvksdllyaytitpydykdcrvnfstthtlnidtqkyrgkdyyissemsyeasqk
    fkrddhvdvfglfyilnshtgeyiyggitpaqnnkvnhkllgnlfisgesqlnnkiilek
    divtfqeidfkirkylnykiypyvsgrieigtkdgkheqidlfdspnegtrsdifakykd
    nriinmknfshfdiylek
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ktkE (E:)
    gavvsqhpsrviaksgtsvkiecrsldfqattmfwyrqfpkqslmlmatsaegskatyeq
    gvekdkflinhasltlstltvtsahpedssfyicsalagsgsstdtqyfgpgtrltvled
    lknfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqpl
    keqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsa
    eawgrad
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ktkF (F:)
    vsqhpsrviaksgtsvkiecrsldfqattmfwyrqfpkqslmlmatsaegskatyeqgve
    kdkflinhasltlstltvtsahpedssfyicsalagsgsstdtqyfgpgtrltvledlkn
    fppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqplkeq
    palndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ktkF (F:)
    vsqhpsrviaksgtsvkiecrsldfqattmfwyrqfpkqslmlmatsaegskatgvekkf
    linhasltlstltvtsahpedssfyicyfgpgtrltvppevavfepvclatgfndsryal
    ssrlqnprnhfrvqfyvtqivsae