PDB entry 1ktd

View 1ktd on RCSB PDB site
Description:
Deposited on 2002-01-15, released 2002-05-01
The last revision prior to the SCOP 1.61 freeze date was dated 2002-05-01, with a file datestamp of 2002-05-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.22
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1ktda1, d1ktda2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1ktdb1, d1ktdb2
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1ktdc1, d1ktdc2
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1ktdd1, d1ktdd2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ktdA (A:)
    ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
    aniavdkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvt
    wlrngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrktwef
    ee
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ktdB (B:)
    aadliaylkqasakggggslvgggsggggsrpwfleycksechfyngtqrvrllvryfyn
    leenlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnflvpr
    rveptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdw
    tfqtlvmletvpqsgevytcqvehpsltdpvtvew
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ktdC (C:)
    ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
    aniavdkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvt
    wlrngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrktwef
    ee
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ktdD (D:)
    aadliaylkqasakggggslvgggsggggsrpwfleycksechfyngtqrvrllvryfyn
    leenlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnflvpr
    rveptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdw
    tfqtlvmletvpqsgevytcqvehpsltdpvtvew