PDB entry 1kt2

View 1kt2 on RCSB PDB site
Description: crystal structure of class ii mhc molecule iek bound to moth cytochrome c peptide
Deposited on 2002-01-15, released 2002-05-01
The last revision prior to the SCOP 1.65 freeze date was dated 2002-05-01, with a file datestamp of 2002-05-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.22
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kt2A (A:)
    ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
    aniavdkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvt
    wlrngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrkhwef
    ee
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kt2B (B:)
    adliaylkqatkggggslvprgsggggsrpwfleycksechfyngtqrvrllvryfynle
    enlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnflvprrv
    eptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdwtf
    qtlvmletvpqsgevytcqvehpsltdpvtvew
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kt2C (C:)
    ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
    aniavdkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvt
    wlrngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrkhwef
    ee
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kt2D (D:)
    adliaylkqatkggggslvprgsggggsrpwfleycksechfyngtqrvrllvryfynle
    enlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnflvprrv
    eptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdwtf
    qtlvmletvpqsgevytcqvehpsltdpvtvew