PDB entry 1ksw

View 1ksw on RCSB PDB site
Description: Structure of Human c-Src Tyrosine Kinase (Thr338Gly Mutant) in Complex with N6-benzyl ADP
Class: transferase
Keywords: SH3, SH2, Kinase, bump hole, bump-hole, chemical genetics, orthogonal substrate, ATP, TRANSFERASE
Deposited on 2002-01-14, released 2002-02-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.231
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12931 (Start-451)
      • engineered (256)
      • modified residue (445)
    Domains in SCOPe 2.06: d1kswa1, d1kswa2, d1kswa3
  • Heterogens: NBS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kswA (A:)
    mvttfvalydyesrtetdlsfkkgerlqivnntegdwwlahslstgqtgyipsnyvapsd
    siqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkh
    ykirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcptskpqtqglakdawe
    ipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkklrhek
    lvqlyavvseepiyivgeymskgslldflkgetgkylrlpqlvdmaaqiasgmayvermn
    yvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikwtapeaalygrfti
    ksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrk
    epeerptfeylqafledyftstepqyqpgenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kswA (A:)
    ttfvalydyesrtetdlsfkkgerlqivnntegdwwlahslstgqtgyipsnyvapsdsi
    qaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkhyk
    irkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcptskpqtqglakdaweip
    reslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkklrheklv
    qlyavvseepiyivgeymskgslldflkgetgkylrlpqlvdmaaqiasgmayvermnyv
    hrdlraanilvgenlvckvadfglarliedneytarqgakfpikwtapeaalygrftiks
    dvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkep
    eerptfeylqafledyftstepqyqpgenl