PDB entry 1ksv

View 1ksv on RCSB PDB site
Description: structure of rsua
Class: lyase
Keywords: Crystal structure, Pseudouridine Synthase, rsuA, LYASE
Deposited on 2002-01-14, released 2002-04-24
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.21
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribosomal small subunit pseudouridine synthase a
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AA43 (3-233)
      • cloning artifact (3)
      • cloning artifact (3)
      • cloning artifact (3)
      • modified residue (3)
      • modified residue (66)
      • modified residue (113)
      • modified residue (191)
    Domains in SCOPe 2.01: d1ksva3, d1ksva4
  • Heterogens: U, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ksvA (A:)
gshmrldkfiaqqlgvsraiagreirgnrvtvdgeivrnaafkllpehdvaydgnplaqq
hgpryfmlnkpqgyvcstddpdhptvlyfldepvawklhaagrldidttglvlmtddgqw
shritsprhhcektylvtlespvaddtaeqfakgvqlhnekdltkpavlevitptqvrlt
isegryhqvkrmfaavgnhvvelhreriggitldadlapgeyrplteeeiasvv