PDB entry 1ksr

View 1ksr on RCSB PDB site
Description: the repeating segments of the f-actin cross-linking gelation factor (abp-120) have an immunoglobulin fold, nmr, 20 structures
Class: actin binding protein
Keywords: actin binding protein, structure, immunoglobulin, gelation factor, abp-120
Deposited on 1997-02-07, released 1997-08-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gelation factor
    Species: Dictyostelium discoideum [TaxId:44689]
    Gene: ABPC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ksra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ksrA (A:)
adpeksyaegpgldggecfqpskfkihavdpdgvhrtdggdgfvvtiegpapvdpvmvdn
gdgtydvefepkeagdyvinltldgdnvngfpktvtvkpa