PDB entry 1ksl

View 1ksl on RCSB PDB site
Description: structure of rsua
Class: lyase
Keywords: Crystal Structure, Pseudouridine Synthase, rsuA, Montreal-Kingston Bacterial Structural Genomics Initiative, BSGI, Structural Genomics
Deposited on 2002-01-13, released 2002-04-24
The last revision prior to the SCOP 1.75 freeze date was dated 2002-06-19, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.226
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribosomal small subunit pseudouridine synthase a
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AA43 (3-233)
      • cloning artifact (3)
      • cloning artifact (3)
      • cloning artifact (3)
      • modified residue (3)
      • modified residue (66)
      • modified residue (113)
      • modified residue (191)
    Domains in SCOP 1.75: d1ksla3, d1ksla4
  • Heterogens: URA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kslA (A:)
    gshmrldkfiaqqlgvsraiagreirgnrvtvdgeivrnaafkllpehdvaydgnplaqq
    hgpryfmlnkpqgyvcstddpdhptvlyfldepvawklhaagrldidttglvlmtddgqw
    shritsprhhcektylvtlespvaddtaeqfakgvqlhnekdltkpavlevitptqvrlt
    isegryhqvkrmfaavgnhvvelhreriggitldadlapgeyrplteeeiasvv