PDB entry 1ksf

View 1ksf on RCSB PDB site
Description: Crystal Structure of ClpA, an HSP100 chaperone and regulator of ClpAP protease: Structural basis of differences in Function of the Two AAA+ ATPase domains
Class: hydrolase, ligand binding protein
Keywords: ClpA, AAA+, ATPases, ATP-dependent protease, Chaperones, Crystal structure
Deposited on 2002-01-12, released 2002-09-27
The last revision prior to the SCOP 1.75 freeze date was dated 2005-04-05, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.221
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: ATP-dependent clp protease ATP-binding subunit clpa
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABH9 (0-End)
      • engineered (168)
    Domains in SCOP 1.75: d1ksfx1, d1ksfx2, d1ksfx3
  • Heterogens: MG, MET, PGE, ADP, IPA, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1ksfX (X:)
    mlnqelelslnmafararehrhefmtvehlllallsnpsarealeacsvdlvalrqelea
    fieqttpvlpaseeerdtqptlsfqrvlqravfhvqssgrnevtganvlvaifseqesqa
    ayllrkhevsrldvvnfishgtrkdeptqssdpgsqpnseeqaggeerlenfttnlnqla
    rvggidpligrekeleraiqvlcrrrknnpllvgesgvgktaiaeglawrivqgdvpevm
    adctiysldigsllagtkyrgdfekrfkallkqleqdtnsilfideihtiigagaasggq
    vdaanlikpllssgkirvigsttyqefsnifekdralarrfqkiditepsieetvqiing
    lkpkyeahhdvrytakavraavelavkyindrhlpdkaidvideagararlmpvskrkkt
    vnvadiesvvariaripeksvsqsdrdtlknlgdrlkmlvfgqdkaiealteaikmarag
    lghehkpvgsflfagptgvgktevtvqlskalgiellrfdmseymerhtvsrligappgy
    vgfdqgglltdavikhphavllldeiekahpdvfnillqvmdngtltdnngrkadfrnvv
    lvmttnagvreterksiglihqdnstdameeikkiftpefrnrldniiwfdhlstdvihq
    vvdkfivelqvqldqkgvslevsqearnwlaekgydramgarpmarviqdnlkkplanel
    lfgslvdggqvtvaldkekneltygfqsaqkhkaeaah
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ksfX (X:)
    mlnqelelslnmafararehrhefmtvehlllallsnpsarealeacsvdlvalrqelea
    fieqttpvlpaseeerdtqptlsfqrvlqravfhvqssgrnevtganvlvaifseqesqa
    ayllrkhevsrldvvnfishgtrlenfttnlnqlarvggidpligrekeleraiqvlcrr
    rknnpllvgesgvgktaiaeglawrivqgdvpevmadctiysldigagtkyrgdfekrfk
    allkqleqdtnsilfideihtiigagaasggqvdaanlikpllssgkirvigsttyqefs
    nifekdralarrfqkiditepsieetvqiinglkpkyeahhdvrytakavraavelavky
    indrhlpdkaidvideagararlmpvskrkktvnvadiesvvariaripeksvsqsdrdt
    lknlgdrlkmlvfgqdkaiealteaikmaraglghehkpvgsflfagptgvgktevtvql
    skalgiellrfdmseymerhtvsrligappgyvgfdqgglltdavikhphavllldeiek
    ahpdvfnillqvmdngtltdnngrkadfrnvvlvmttnagvrnstdameeikkiftpefr
    nrldniiwfdhlstdvihqvvdkfivelqvqldqkgvslevsqearnwlaekgydramga
    rpmarviqdnlkkplanellfgslvdggqvtvaldkekneltygfqsaqkhkae