PDB entry 1krv

View 1krv on RCSB PDB site
Description: Galactoside Acetyltransferase in Complex with CoA and PNP-beta-Gal
Class: transferase
Keywords: Left-Handed Parallel Beta Helix, TRANSFERASE
Deposited on 2002-01-10, released 2002-04-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: galactoside o-acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: laca
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1krva_
  • Chain 'B':
    Compound: galactoside o-acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: laca
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1krvb_
  • Chain 'C':
    Compound: galactoside o-acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: laca
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1krvc_
  • Heterogens: 147, COA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1krvA (A:)
    mnmpmteriragklftdmceglpekrlrgktlmyefnhshpsevekreslikemfatvge
    nawveppvyfsygsnihigrnfyanfnltivddytvtigdnvliapnvtlsvtghpvhhe
    lrkngemysfpitignnvwigshvvinpgvtigdnsvigagsivtkdippnvvaagvpcr
    vireindrdkhyyfkdykvessv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1krvA (A:)
    nmpmteriragklftdmceglpekrlrgktlmyefnhshpsevekreslikemfatvgen
    awveppvyfsygsnihigrnfyanfnltivddytvtigdnvliapnvtlsvtghpvhhel
    rkngemysfpitignnvwigshvvinpgvtigdnsvigagsivtkdippnvvaagvpcrv
    ireindrdkhyyfkdykvess
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1krvB (B:)
    mnmpmteriragklftdmceglpekrlrgktlmyefnhshpsevekreslikemfatvge
    nawveppvyfsygsnihigrnfyanfnltivddytvtigdnvliapnvtlsvtghpvhhe
    lrkngemysfpitignnvwigshvvinpgvtigdnsvigagsivtkdippnvvaagvpcr
    vireindrdkhyyfkdykvessv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1krvB (B:)
    nmpmteriragklftdmceglpekrlrgktlmyefnhshpsevekreslikemfatvgen
    awveppvyfsygsnihigrnfyanfnltivddytvtigdnvliapnvtlsvtghpvhhel
    rkngemysfpitignnvwigshvvinpgvtigdnsvigagsivtkdippnvvaagvpcrv
    ireindrdkhyyfkdykvess
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1krvC (C:)
    mnmpmteriragklftdmceglpekrlrgktlmyefnhshpsevekreslikemfatvge
    nawveppvyfsygsnihigrnfyanfnltivddytvtigdnvliapnvtlsvtghpvhhe
    lrkngemysfpitignnvwigshvvinpgvtigdnsvigagsivtkdippnvvaagvpcr
    vireindrdkhyyfkdykvessv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1krvC (C:)
    nmpmteriragklftdmceglpekrlrgktlmyefnhshpsevekreslikemfatvgen
    awveppvyfsygsnihigrnfyanfnltivddytvtigdnvliapnvtlsvtghpvhhel
    rkngemysfpitignnvwigshvvinpgvtigdnsvigagsivtkdippnvvaagvpcrv
    ireindrdkhyyfkdykvess