PDB entry 1krr

View 1krr on RCSB PDB site
Description: Galactoside Acetyltransferase in Complex with Acetyl-Coenzyme A
Class: transferase
Keywords: Left-Handed Parallel Beta Helix, TRANSFERASE
Deposited on 2002-01-10, released 2002-04-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: galactoside o-acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: laca
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1krra_
  • Chain 'B':
    Compound: galactoside o-acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: laca
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1krrb_
  • Chain 'C':
    Compound: galactoside o-acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: laca
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1krrc_
  • Heterogens: ACO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1krrA (A:)
    mnmpmteriragklftdmceglpekrlrgktlmyefnhshpsevekreslikemfatvge
    nawveppvyfsygsnihigrnfyanfnltivddytvtigdnvliapnvtlsvtghpvhhe
    lrkngemysfpitignnvwigshvvinpgvtigdnsvigagsivtkdippnvvaagvpcr
    vireindrdkhyyfkdykvessv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1krrA (A:)
    nmpmteriragklftdmceglpekrlrgktlmyefnhshpsevekreslikemfatvgen
    awveppvyfsygsnihigrnfyanfnltivddytvtigdnvliapnvtlsvtghpvhhel
    rkngemysfpitignnvwigshvvinpgvtigdnsvigagsivtkdippnvvaagvpcrv
    ireindrdkhyyfkdykves
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1krrB (B:)
    mnmpmteriragklftdmceglpekrlrgktlmyefnhshpsevekreslikemfatvge
    nawveppvyfsygsnihigrnfyanfnltivddytvtigdnvliapnvtlsvtghpvhhe
    lrkngemysfpitignnvwigshvvinpgvtigdnsvigagsivtkdippnvvaagvpcr
    vireindrdkhyyfkdykvessv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1krrB (B:)
    nmpmteriragklftdmceglpekrlrgktlmyefnhshpsevekreslikemfatvgen
    awveppvyfsygsnihigrnfyanfnltivddytvtigdnvliapnvtlsvtghpvhhel
    rkngemysfpitignnvwigshvvinpgvtigdnsvigagsivtkdippnvvaagvpcrv
    ireindrdkhyyfkdykves
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1krrC (C:)
    mnmpmteriragklftdmceglpekrlrgktlmyefnhshpsevekreslikemfatvge
    nawveppvyfsygsnihigrnfyanfnltivddytvtigdnvliapnvtlsvtghpvhhe
    lrkngemysfpitignnvwigshvvinpgvtigdnsvigagsivtkdippnvvaagvpcr
    vireindrdkhyyfkdykvessv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1krrC (C:)
    nmpmteriragklftdmceglpekrlrgktlmyefnhshpsevekreslikemfatvgen
    awveppvyfsygsnihigrnfyanfnltivddytvtigdnvliapnvtlsvtghpvhhel
    rkngemysfpitignnvwigshvvinpgvtigdnsvigagsivtkdippnvvaagvpcrv
    ireindrdkhyyfkdykves