PDB entry 1krq

View 1krq on RCSB PDB site
Description: crystal structure analysis of campylobacter jejuni ferritin
Class: metal binding protein
Keywords: bacterial non-heme ferritin, H-chain like four-helix bundle, METAL BINDING PROTEIN
Deposited on 2002-01-10, released 2002-02-06
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.203
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferritin
    Species: Campylobacter jejuni [TaxId:197]
    Gene: cft
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1krqa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1krqA (A:)
    mlskevvkllneqinkemyaanlylsmsswcyensldgagaflfahaseesdhakklity
    lnetdshvelqevkqpeqnfkslldvfektyeheqfitksintlvehmlthkdystfnfl
    qwyvseqheeealfrgivdkikligehgnglyladqyiknialsrkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1krqA (A:)
    mlskevvkllneqinkemyaanlylsmsswcyensldgagaflfahaseesdhakklity
    lnetdshvelqevkqpeqnfkslldvfektyeheqfitksintlvehmlthkdystfnfl
    qwyvseqheeealfrgivdkikligehgnglyladqyiknialsr