PDB entry 1krq

View 1krq on RCSB PDB site
Description: crystal structure analysis of campylobacter jejuni ferritin
Deposited on 2002-01-10, released 2002-02-06
The last revision prior to the SCOP 1.59 freeze date was dated 2002-02-06, with a file datestamp of 2002-02-06.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.203
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1krqa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1krqA (A:)
mlskevvkllneqinkemyaanlylsmsswcyensldgagaflfahaseesdhakklity
lnetdshvelqevkqpeqnfkslldvfektyeheqfitksintlvehmlthkdystfnfl
qwyvseqheeealfrgivdkikligehgnglyladqyiknialsr