PDB entry 1kqg

View 1kqg on RCSB PDB site
Description: formate dehydrogenase n from e. coli
Class: oxidoreductase
Keywords: oxidoreductase, selenium, selenocysteine, secys, molybdenum, molybdopterin, mpt, molybdopterin guanine dinucleotide, mgd, iron sulfur cluster, fe4s4, formate, dehydrogenase, anaerobic, integral membrane protein
Deposited on 2002-01-05, released 2002-03-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-02-19, with a file datestamp of 2014-02-14.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.198
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: formate dehydrogenase, nitrate-inducible, major subunit
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1kqga1, d1kqga2
  • Chain 'B':
    Compound: formate dehydrogenase, nitrate-inducible, iron-sulfur subunit
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1kqgb1, d1kqgb2
  • Chain 'C':
    Compound: formate dehydrogenase, nitrate-inducible, cytochrome b556(fdn) subunit
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1kqgc_
  • Heterogens: SF4, MGD, 6MO, HEM, HQO, CDL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kqgA (A:)
    mdvsrrqffkicaggmagttvaalgfapkqalaqarnykllrakeirntctycsvgcgll
    myslgdgaknareaiyhiegdpdhpvsrgalcpkgaglldyvnsenrlrypeyrapgsdk
    wqrisweeafsriaklmkadrdanfiekneqgvtvnrwlstgmlcasgasnetgmltqkf
    arslgmlavdnqarvahgptvaslaptfgrgamtnhwvdiknanvvmvmggnaaeahpvg
    frwameaknnndatlivvdprftrtasvadiyapirsgtditflsgvlryliennkinae
    yvkhytnasllvrddfafedglfsgydaekrqydksswnyqldengyakrdetlthprcv
    wnllkehvsrytpdvvenicgtpkadflkvcevlastsapdrtttflyalgwtqhtvgaq
    nirtmamiqlllgnmgmagggvnalrghsniqgltdlgllstslpgyltlpsekqvdlqs
    yleantpkatladqvnywsnypkffvslmksfygdaaqkennwgydwlpkwdqtydviky
    fnmmdegkvtgyfcqgfnpvasfpdknkvvsclsklkymvvidplvtetstfwqnhgesn
    dvdpasiqtevfrlpstcfaeedgsiansgrwlqwhwkgqdapgearndgeilagiyhhl
    relyqseggkgveplmkmswnykqphepqsdevakenngyaledlydangvliakkgqll
    ssfahlrddgttasscwiytgswteqgnqmanrdnsdpsglgntlgwawawplnrrvlyn
    rasadingkpwdpkrmliqwngskwtgndipdfgnaapgtptgpfimqpegmgrlfaink
    maegpfpehyepietplgtnplhpnvvsnpvvrlyeqdalrmgkkeqfpyvgttyrlteh
    fhtwtkhallnaiaqpeqfveisetlaaakginngdrvtvsskrgfiravavvtrrlkpl
    nvngqqvetvgipihwgfegvarkgyiantltpnvgdansqtpeykaflvnieka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kqgA (A:)
    qarnykllrakeirntctycsvgcgllmyslgdgaknareaiyhiegdpdhpvsrgalcp
    kgaglldyvnsenrlrypeyrapgsdkwqrisweeafsriaklmkadrdanfiekneqgv
    tvnrwlstgmlcasgasnetgmltqkfarslgmlavdnqarvahgptvaslaptfgrgam
    tnhwvdiknanvvmvmggnaaeahpvgfrwameaknnndatlivvdprftrtasvadiya
    pirsgtditflsgvlryliennkinaeyvkhytnasllvrddfafedglfsgydaekrqy
    dksswnyqldengyakrdetlthprcvwnllkehvsrytpdvvenicgtpkadflkvcev
    lastsapdrtttflyalgwtqhtvgaqnirtmamiqlllgnmgmagggvnalrghsniqg
    ltdlgllstslpgyltlpsekqvdlqsyleantpkatladqvnywsnypkffvslmksfy
    gdaaqkennwgydwlpkwdqtydvikyfnmmdegkvtgyfcqgfnpvasfpdknkvvscl
    sklkymvvidplvtetstfwqnhgesndvdpasiqtevfrlpstcfaeedgsiansgrwl
    qwhwkgqdapgearndgeilagiyhhlrelyqseggkgveplmkmswnykqphepqsdev
    akenngyaledlydangvliakkgqllssfahlrddgttasscwiytgswteqgnqmanr
    dnsdpsglgntlgwawawplnrrvlynrasadingkpwdpkrmliqwngskwtgndipdf
    gnaapgtptgpfimqpegmgrlfainkmaegpfpehyepietplgtnplhpnvvsnpvvr
    lyeqdalrmgkkeqfpyvgttyrltehfhtwtkhallnaiaqpeqfveisetlaaakgin
    ngdrvtvsskrgfiravavvtrrlkplnvngqqvetvgipihwgfegvarkgyiantltp
    nvgdansqtpeykaflvnieka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kqgB (B:)
    mametqdiikrsatnsitppsqvrdykaevaklidvstcigckacqvacsewndirdevg
    hcvgvydnpadlsakswtvmrfseteqngklewlirkdgcmhcedpgclkacpsagaiiq
    yangivdfqsencigcgyciagcpfniprlnkednrvykctlcvdrvsvgqepacvktcp
    tgaihfgtkkemlelaeqrvaklkargyehagvynpegvggthvmyvlhhadqpelyhgl
    pkdpkidtsvslwkgalkplaaagfiatfaglifhyigigpnkevdddeedhhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kqgB (B:)
    ametqdiikrsatnsitppsqvrdykaevaklidvstcigckacqvacsewndirdevgh
    cvgvydnpadlsakswtvmrfseteqngklewlirkdgcmhcedpgclkacpsagaiiqy
    angivdfqsencigcgyciagcpfniprlnkednrvykctlcvdrvsvgqepacvktcpt
    gaihfgtkkemlelaeqrvaklkargyehagvynpegvggthvmyvlhhadqpelyhglp
    kdpkidtsvslwkgalkplaaagfiatfaglifhyigigpnkevdddee
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1kqgC (C:)
    mskskmivrtkfidrachwtvvicfflvalsgisfffptlqwltqtfgtpqmgrilhpff
    giaifvalmfmfvrfvhhnipdkkdipwllnivevlkgnehkvadvgkynagqkmmfwsi
    msmifvllvtgviiwrpyfaqyfpmqvvrysllihaaagiilihailihmymafwvkgsi
    kgmiegkvsrrwakkhhprwyreiekaeakkeseegi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kqgC (C:)
    skskmivrtkfidrachwtvvicfflvalsgisfffptlqwltqtfgtpqmgrilhpffg
    iaifvalmfmfvrfvhhnipdkkdipwllnivevlkgnehkvadvgkynagqkmmfwsim
    smifvllvtgviiwrpyfaqyfpmqvvrysllihaaagiilihailihmymafwvkgsik
    gmiegkvsrrwakkhhprwyreiekaeakkeseegi