PDB entry 1kqg

View 1kqg on RCSB PDB site
Description: formate dehydrogenase n from e. coli
Deposited on 2002-01-05, released 2002-03-15
The last revision prior to the SCOP 1.61 freeze date was dated 2002-03-15, with a file datestamp of 2002-03-15.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.198
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kqgA (A:)
    qarnykllrakeirntctycsvgcgllmyslgdgaknareaiyhiegdpdhpvsrgalcp
    kgaglldyvnsenrlrypeyrapgsdkwqrisweeafsriaklmkadrdanfiekneqgv
    tvnrwlstgmlcasgasnetgmltqkfarslgmlavdnqarvchgptvaslaptfgrgam
    tnhwvdiknanvvmvmggnaaeahpvgfrwameaknnndatlivvdprftrtasvadiya
    pirsgtditflsgvlryliennkinaeyvkhytnasllvrddfafedglfsgydaekrqy
    dksswnyqldengyakrdetlthprcvwnllkehvsrytpdvvenicgtpkadflkvcev
    lastsapdrtttflyalgwtqhtvgaqnirtmamiqlllgnmgmagggvnalrghsniqg
    ltdlgllstslpgyltlpsekqvdlqsyleantpkatladqvnywsnypkffvslmksfy
    gdaaqkennwgydwlpkwdqtydvikyfnmmdegkvtgyfcqgfnpvasfpdknkvvscl
    sklkymvvidplvtetstfwqnhgesndvdpasiqtevfrlpstcfaeedgsiansgrwl
    qwhwkgqdapgearndgeilagiyhhlrelyqseggkgveplmkmswnykqphepqsdev
    akenngyaledlydangvliakkgqllssfahlrddgttasscwiytgswteqgnqmanr
    dnsdpsglgntlgwawawplnrrvlynrasadingkpwdpkrmliqwngskwtgndipdf
    gnaapgtptgpfimqpegmgrlfainkmaegpfpehyepietplgtnplhpnvvsnpvvr
    lyeqdalrmgkkeqfpyvgttyrltehfhtwtkhallnaiaqpeqfveisetlaaakgin
    ngdrvtvsskrgfiravavvtrrlkplnvngqqvetvgipihwgfegvarkgyiantltp
    nvgdansqtpeykaflvnieka
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kqgB (B:)
    ametqdiikrsatnsitppsqvrdykaevaklidvstcigckacqvacsewndirdevgh
    cvgvydnpadlsakswtvmrfseteqngklewlirkdgcmhcedpgclkacpsagaiiqy
    angivdfqsencigcgyciagcpfniprlnkednrvykctlcvdrvsvgqepacvktcpt
    gaihfgtkkemlelaeqrvaklkargyehagvynpegvggthvmyvlhhadqpelyhglp
    kdpkidtsvslwkgalkplaaagfiatfaglifhyigigpnkevdddee
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kqgC (C:)
    skskmivrtkfidrachwtvvicfflvalsgisfffptlqwltqtfgtpqmgrilhpffg
    iaifvalmfmfvrfvhhnipdkkdipwllnivevlkgnehkvadvgkynagqkmmfwsim
    smifvllvtgviiwrpyfaqyfpmqvvrysllihaaagiilihailihmymafwvkgsik
    gmiegkvsrrwakkhhprwyreiekaeakkeseegi