PDB entry 1kqa

View 1kqa on RCSB PDB site
Description: galactoside acetyltransferase in complex with coenzyme a
Class: transferase
Keywords: left-handed parallel beta helix, transferase
Deposited on 2002-01-04, released 2002-04-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: galactoside o-acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: laca
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kqaa_
  • Chain 'B':
    Compound: galactoside o-acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: laca
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kqab_
  • Chain 'C':
    Compound: galactoside o-acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: laca
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kqac_
  • Heterogens: COA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kqaA (A:)
    mnmpmteriragklftdmceglpekrlrgktlmyefnhshpsevekreslikemfatvge
    nawveppvyfsygsnihigrnfyanfnltivddytvtigdnvliapnvtlsvtghpvhhe
    lrkngemysfpitignnvwigshvvinpgvtigdnsvigagsivtkdippnvvaagvpcr
    vireindrdkhyyfkdykvessv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kqaA (A:)
    nmpmteriragklftdmceglpekrlrgktlmyefnhshpsevekreslikemfatvgen
    awveppvyfsygsnihigrnfyanfnltivddytvtigdnvliapnvtlsvtghpvhhel
    rkngemysfpitignnvwigshvvinpgvtigdnsvigagsivtkdippnvvaagvpcrv
    ireindrdkhyyfkdykves
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kqaB (B:)
    mnmpmteriragklftdmceglpekrlrgktlmyefnhshpsevekreslikemfatvge
    nawveppvyfsygsnihigrnfyanfnltivddytvtigdnvliapnvtlsvtghpvhhe
    lrkngemysfpitignnvwigshvvinpgvtigdnsvigagsivtkdippnvvaagvpcr
    vireindrdkhyyfkdykvessv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kqaB (B:)
    nmpmteriragklftdmceglpekrlrgktlmyefnhshpsevekreslikemfatvgen
    awveppvyfsygsnihigrnfyanfnltivddytvtigdnvliapnvtlsvtghpvhhel
    rkngemysfpitignnvwigshvvinpgvtigdnsvigagsivtkdippnvvaagvpcrv
    ireindrdkhyyfkdykves
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1kqaC (C:)
    mnmpmteriragklftdmceglpekrlrgktlmyefnhshpsevekreslikemfatvge
    nawveppvyfsygsnihigrnfyanfnltivddytvtigdnvliapnvtlsvtghpvhhe
    lrkngemysfpitignnvwigshvvinpgvtigdnsvigagsivtkdippnvvaagvpcr
    vireindrdkhyyfkdykvessv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kqaC (C:)
    nmpmteriragklftdmceglpekrlrgktlmyefnhshpsevekreslikemfatvgen
    awveppvyfsygsnihigrnfyanfnltivddytvtigdnvliapnvtlsvtghpvhhel
    rkngemysfpitignnvwigshvvinpgvtigdnsvigagsivtkdippnvvaagvpcrv
    ireindrdkhyyfkdykves