PDB entry 1kq3

View 1kq3 on RCSB PDB site
Description: crystal structure of a glycerol dehydrogenase (tm0423) from thermotoga maritima at 1.5 a resolution
Class: oxidoreductase
Keywords: glycerol dehydrogenase, structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi, oxidoreductase
Deposited on 2002-01-03, released 2002-02-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.173
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycerol dehydrogenase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0423
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYQ4 (12-End)
      • expression tag (11)
    Domains in SCOPe 2.05: d1kq3a_
  • Heterogens: ZN, CL, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kq3A (A:)
    mgsdkihhhhhhmitttifpgryvqgagainileeelsrfgerafvviddfvdknvlgen
    ffssftkvrvnkqifggecsdeeierlsglveeetdvvvgigggktldtakavayklkkp
    vvivptiastdapcsalsviytpngefkrylflprnpdvvlvdteivakaparflvagmg
    dalatwfeaesckqkyapnmtgrlgsmtayalarlcyetlleygvlakrsveeksvtpal
    ekiveantllsglgfesgglaaahaihngltvlenthkylhgekvaigvlaslfltdkpr
    kmieevysfceevglpttlaeigldgvsdedlmkvaekacdknetihnepqpvtskdvff
    alkaadrygrmrknlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kq3A (A:)
    hmitttifpgryvqgagainileeelsrfgerafvviddfvdknvlgenffssftkvrvn
    kqifggecsdeeierlsglveeetdvvvgigggktldtakavayklkkpvvivptiastd
    apcsalsviytpngefkrylflprnpdvvlvdteivakaparflvagmgdalatwfeaes
    ckqkyapnmtgrlgsmtayalarlcyetlleygvlakrsveeksvtpalekiveantlls
    glgfesgglaaahaihngltvlenthkylhgekvaigvlaslfltdkprkmieevysfce
    evglpttlaeigldgvsdedlmkvaekacdknetihnepqpvtskdvffalkaadrygrm
    rknl