PDB entry 1kpl

View 1kpl on RCSB PDB site
Description: Crystal Structure of the ClC Chloride Channel from S. typhimurium
Class: membrane protein
Keywords: helical membrane protein, homodimer, ion channel, MEMBRANE PROTEIN
Deposited on 2001-12-31, released 2002-01-23
The last revision prior to the SCOPe 2.03 freeze date was dated 2010-12-22, with a file datestamp of 2010-12-17.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.254
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative ClC family, chlorine transport protein
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZRP8
      • engineered (263)
    Domains in SCOPe 2.03: d1kpla_
  • Chain 'B':
    Compound: putative ClC family, chlorine transport protein
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZRP8
      • engineered (25)
      • engineered (263)
    Domains in SCOPe 2.03: d1kplb_
  • Chain 'C':
    Compound: putative ClC family, chlorine transport protein
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZRP8
      • engineered (263)
    Domains in SCOPe 2.03: d1kplc_
  • Chain 'D':
    Compound: putative ClC family, chlorine transport protein
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZRP8
      • engineered (25)
      • engineered (263)
    Domains in SCOPe 2.03: d1kpld_
  • Heterogens: CL, SO4, MYS, OCT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kplA (A:)
    mktdtstflaqqivrlrrrdqirrllqrdktplailfmaavvgtltglvgvafekavswv
    qnmrigalvqvadhafllwplafilsallamvgyflvrkfapeaggsgipeiegaleelr
    pvrwwrvlpvkfiggmgtlgagmvlgregptvqiggnlgrmvldvfrmrsaearhtllat
    gaaaglsaafnaplagilfiieemrpqfrynlisikavftgvimssivfrifngeapiie
    vgklsdapvntlwlylilgiifgvvgpvfnslvlrtqdmfqrfhggeikkwvlmggaigg
    lcgilgliepaaagggfnlipiaaagnfsvglllfifitrvvttllcfssgapggifapm
    lalgtllgtafgmaaavlfpqyhleagtfaiagmgalmaasvrapltgivlvlemtdnyq
    lilpmiitclgatllaqflggkplystilartlakqdaeqaeknqnapadent
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kplA (A:)
    tplailfmaavvgtltglvgvafekavswvqnmrigalvqvadhafllwplafilsalla
    mvgyflvrkfapeaggsgipeiegaleelrpvrwwrvlpvkfiggmgtlgagmvlgregp
    tvqiggnlgrmvldvfrmrsaearhtllatgaaaglsaafnaplagilfiieemrpqfry
    nlisikavftgvimssivfrifngeapiievgklsdapvntlwlylilgiifgvvgpvfn
    slvlrtqdmfqrfhggeikkwvlmggaigglcgilgliepaaagggfnlipiaaagnfsv
    glllfifitrvvttllcfssgapggifapmlalgtllgtafgmaaavlfpqyhleagtfa
    iagmgalmaasvrapltgivlvlemtdnyqlilpmiitclgatllaqflggkplystila
    rtlakqdaeq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kplB (B:)
    mktdtstflaqqivrlrrrdqirrllqrdktplailfmaavvgtltglvgvafekavswv
    qnmrigalvqvadhafllwplafilsallamvgyflvrkfapeaggsgipeiegaleelr
    pvrwwrvlpvkfiggmgtlgagmvlgregptvqiggnlgrmvldvfrmrsaearhtllat
    gaaaglsaafnaplagilfiieemrpqfrynlisikavftgvimssivfrifngeapiie
    vgklsdapvntlwlylilgiifgvvgpvfnslvlrtqdmfqrfhggeikkwvlmggaigg
    lcgilgliepaaagggfnlipiaaagnfsvglllfifitrvvttllcfssgapggifapm
    lalgtllgtafgmaaavlfpqyhleagtfaiagmgalmaasvrapltgivlvlemtdnyq
    lilpmiitclgatllaqflggkplystilartlakqdaeqaeknqnapadent
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kplB (B:)
    qivrlrrrdqirrllqrdktplailfmaavvgtltglvgvafekavswvqnmrigalvqv
    adhafllwplafilsallamvgyflvrkfapeaggsgipeiegaleelrpvrwwrvlpvk
    figgmgtlgagmvlgregptvqiggnlgrmvldvfrmrsaearhtllatgaaaglsaafn
    aplagilfiieemrpqfrynlisikavftgvimssivfrifngeapiievgklsdapvnt
    lwlylilgiifgvvgpvfnslvlrtqdmfqrfhggeikkwvlmggaigglcgilgliepa
    aagggfnlipiaaagnfsvglllfifitrvvttllcfssgapggifapmlalgtllgtaf
    gmaaavlfpqyhleagtfaiagmgalmaasvrapltgivlvlemtdnyqlilpmiitclg
    atllaqflggkplystilartlakqdaeqae
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1kplC (C:)
    mktdtstflaqqivrlrrrdqirrllqrdktplailfmaavvgtltglvgvafekavswv
    qnmrigalvqvadhafllwplafilsallamvgyflvrkfapeaggsgipeiegaleelr
    pvrwwrvlpvkfiggmgtlgagmvlgregptvqiggnlgrmvldvfrmrsaearhtllat
    gaaaglsaafnaplagilfiieemrpqfrynlisikavftgvimssivfrifngeapiie
    vgklsdapvntlwlylilgiifgvvgpvfnslvlrtqdmfqrfhggeikkwvlmggaigg
    lcgilgliepaaagggfnlipiaaagnfsvglllfifitrvvttllcfssgapggifapm
    lalgtllgtafgmaaavlfpqyhleagtfaiagmgalmaasvrapltgivlvlemtdnyq
    lilpmiitclgatllaqflggkplystilartlakqdaeqaeknqnapadent
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kplC (C:)
    tplailfmaavvgtltglvgvafekavswvqnmrigalvqvadhafllwplafilsalla
    mvgyflvrkfapeaggsgipeiegaleelrpvrwwrvlpvkfiggmgtlgagmvlgregp
    tvqiggnlgrmvldvfrmrsaearhtllatgaaaglsaafnaplagilfiieemrpqfry
    nlisikavftgvimssivfrifngeapiievgklsdapvntlwlylilgiifgvvgpvfn
    slvlrtqdmfqrfhggeikkwvlmggaigglcgilgliepaaagggfnlipiaaagnfsv
    glllfifitrvvttllcfssgapggifapmlalgtllgtafgmaaavlfpqyhleagtfa
    iagmgalmaasvrapltgivlvlemtdnyqlilpmiitclgatllaqflggkplystila
    rtlakqdaeq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1kplD (D:)
    mktdtstflaqqivrlrrrdqirrllqrdktplailfmaavvgtltglvgvafekavswv
    qnmrigalvqvadhafllwplafilsallamvgyflvrkfapeaggsgipeiegaleelr
    pvrwwrvlpvkfiggmgtlgagmvlgregptvqiggnlgrmvldvfrmrsaearhtllat
    gaaaglsaafnaplagilfiieemrpqfrynlisikavftgvimssivfrifngeapiie
    vgklsdapvntlwlylilgiifgvvgpvfnslvlrtqdmfqrfhggeikkwvlmggaigg
    lcgilgliepaaagggfnlipiaaagnfsvglllfifitrvvttllcfssgapggifapm
    lalgtllgtafgmaaavlfpqyhleagtfaiagmgalmaasvrapltgivlvlemtdnyq
    lilpmiitclgatllaqflggkplystilartlakqdaeqaeknqnapadent
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kplD (D:)
    qivrlrrrdqirrllqrdktplailfmaavvgtltglvgvafekavswvqnmrigalvqv
    adhafllwplafilsallamvgyflvrkfapeaggsgipeiegaleelrpvrwwrvlpvk
    figgmgtlgagmvlgregptvqiggnlgrmvldvfrmrsaearhtllatgaaaglsaafn
    aplagilfiieemrpqfrynlisikavftgvimssivfrifngeapiievgklsdapvnt
    lwlylilgiifgvvgpvfnslvlrtqdmfqrfhggeikkwvlmggaigglcgilgliepa
    aagggfnlipiaaagnfsvglllfifitrvvttllcfssgapggifapmlalgtllgtaf
    gmaaavlfpqyhleagtfaiagmgalmaasvrapltgivlvlemtdnyqlilpmiitclg
    atllaqflggkplystilartlakqdaeqae