PDB entry 1kpk

View 1kpk on RCSB PDB site
Description: Crystal Structure of the ClC Chloride Channel from E. coli
Class: membrane protein
Keywords: helical membrane protein, homodimer
Deposited on 2001-12-31, released 2002-01-23
The last revision prior to the SCOP 1.73 freeze date was dated 2002-01-23, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.29
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative channel transporter
    Species: Escherichia coli
    Gene: yadQ
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1kpka_
  • Chain 'B':
    Compound: putative channel transporter
    Species: Escherichia coli
    Gene: yadQ
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1kpkb_
  • Chain 'C':
    Compound: putative channel transporter
    Species: Escherichia coli
    Gene: yadQ
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1kpkc_
  • Chain 'D':
    Compound: putative channel transporter
    Species: Escherichia coli
    Gene: yadQ
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1kpkd_
  • Chain 'E':
    Compound: putative channel transporter
    Species: Escherichia coli
    Gene: yadQ
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1kpke_
  • Chain 'F':
    Compound: putative channel transporter
    Species: Escherichia coli
    Gene: yadQ
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1kpkf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kpkA (A:)
    mktdtpsletpqaarlrrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawl
    qnqrmgalvhtadnypllltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqr
    pvrwwrvlpvkffgglgtlgggmvlgregptvqiggnigrmvldifrlkgdearhtllat
    gaaaglaaafnaplagilfiieemrpqfrytlisikavfigvimstimyrifnhevalid
    vgklsdaplntlwlylilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigg
    lcgllgfvapatsgggfnlipiatagnfsmgmlvfifvarvittllcfssgapggifapm
    lalgtvlgtafgmvavelfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyq
    lilpmiitglgatllaqftggkplysailartlakqeaeqlarskaasasent
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kpkA (A:)
    qaarlrrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvht
    adnypllltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvk
    ffgglgtlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafn
    aplagilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplnt
    lwlylilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapa
    tsgggfnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtaf
    gmvavelfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglg
    atllaqftggkplysailartlakqeaeql
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kpkB (B:)
    mktdtpsletpqaarlrrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawl
    qnqrmgalvhtadnypllltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqr
    pvrwwrvlpvkffgglgtlgggmvlgregptvqiggnigrmvldifrlkgdearhtllat
    gaaaglaaafnaplagilfiieemrpqfrytlisikavfigvimstimyrifnhevalid
    vgklsdaplntlwlylilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigg
    lcgllgfvapatsgggfnlipiatagnfsmgmlvfifvarvittllcfssgapggifapm
    lalgtvlgtafgmvavelfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyq
    lilpmiitglgatllaqftggkplysailartlakqeaeqlarskaasasent
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kpkB (B:)
    qaarlrrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvht
    adnypllltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvk
    ffgglgtlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafn
    aplagilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplnt
    lwlylilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapa
    tsgggfnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtaf
    gmvavelfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglg
    atllaqftggkplysailartlakqeaeql
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1kpkC (C:)
    mktdtpsletpqaarlrrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawl
    qnqrmgalvhtadnypllltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqr
    pvrwwrvlpvkffgglgtlgggmvlgregptvqiggnigrmvldifrlkgdearhtllat
    gaaaglaaafnaplagilfiieemrpqfrytlisikavfigvimstimyrifnhevalid
    vgklsdaplntlwlylilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigg
    lcgllgfvapatsgggfnlipiatagnfsmgmlvfifvarvittllcfssgapggifapm
    lalgtvlgtafgmvavelfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyq
    lilpmiitglgatllaqftggkplysailartlakqeaeqlarskaasasent
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kpkC (C:)
    qaarlrrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvht
    adnypllltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvk
    ffgglgtlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafn
    aplagilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplnt
    lwlylilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapa
    tsgggfnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtaf
    gmvavelfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglg
    atllaqftggkplysailartlakqeaeql
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1kpkD (D:)
    mktdtpsletpqaarlrrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawl
    qnqrmgalvhtadnypllltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqr
    pvrwwrvlpvkffgglgtlgggmvlgregptvqiggnigrmvldifrlkgdearhtllat
    gaaaglaaafnaplagilfiieemrpqfrytlisikavfigvimstimyrifnhevalid
    vgklsdaplntlwlylilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigg
    lcgllgfvapatsgggfnlipiatagnfsmgmlvfifvarvittllcfssgapggifapm
    lalgtvlgtafgmvavelfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyq
    lilpmiitglgatllaqftggkplysailartlakqeaeqlarskaasasent
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kpkD (D:)
    qaarlrrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvht
    adnypllltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvk
    ffgglgtlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafn
    aplagilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplnt
    lwlylilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapa
    tsgggfnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtaf
    gmvavelfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglg
    atllaqftggkplysailartlakqeaeql
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1kpkE (E:)
    mktdtpsletpqaarlrrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawl
    qnqrmgalvhtadnypllltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqr
    pvrwwrvlpvkffgglgtlgggmvlgregptvqiggnigrmvldifrlkgdearhtllat
    gaaaglaaafnaplagilfiieemrpqfrytlisikavfigvimstimyrifnhevalid
    vgklsdaplntlwlylilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigg
    lcgllgfvapatsgggfnlipiatagnfsmgmlvfifvarvittllcfssgapggifapm
    lalgtvlgtafgmvavelfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyq
    lilpmiitglgatllaqftggkplysailartlakqeaeqlarskaasasent
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kpkE (E:)
    qaarlrrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvht
    adnypllltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvk
    ffgglgtlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafn
    aplagilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplnt
    lwlylilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapa
    tsgggfnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtaf
    gmvavelfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglg
    atllaqftggkplysailartlakqeaeql
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1kpkF (F:)
    mktdtpsletpqaarlrrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawl
    qnqrmgalvhtadnypllltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqr
    pvrwwrvlpvkffgglgtlgggmvlgregptvqiggnigrmvldifrlkgdearhtllat
    gaaaglaaafnaplagilfiieemrpqfrytlisikavfigvimstimyrifnhevalid
    vgklsdaplntlwlylilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigg
    lcgllgfvapatsgggfnlipiatagnfsmgmlvfifvarvittllcfssgapggifapm
    lalgtvlgtafgmvavelfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyq
    lilpmiitglgatllaqftggkplysailartlakqeaeqlarskaasasent
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kpkF (F:)
    qaarlrrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvht
    adnypllltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvk
    ffgglgtlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafn
    aplagilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplnt
    lwlylilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapa
    tsgggfnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtaf
    gmvavelfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglg
    atllaqftggkplysailartlakqeaeql