PDB entry 1kpj

View 1kpj on RCSB PDB site
Description: Crystal structure of the large ribosomal subunit from Deinococcus radiodurans
Deposited on 2001-12-31, released 2002-01-07
The last revision prior to the SCOP 1.59 freeze date was dated 2002-01-07, with a file datestamp of 2002-01-07.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.24
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '0':
    Domains in SCOP 1.59: d1kpj0_
  • Chain '1':
    Domains in SCOP 1.59: d1kpj1_
  • Chain '2':
    Domains in SCOP 1.59: d1kpj2_
  • Chain '3':
    Domains in SCOP 1.59: d1kpj3_
  • Chain '4':
    Domains in SCOP 1.59: d1kpj4_
  • Chain '9':
    Domains in SCOP 1.59: d1kpj9_
  • Chain 'A':
    Domains in SCOP 1.59: d1kpja_
  • Chain 'B':
    Domains in SCOP 1.59: d1kpjb_
  • Chain 'C':
    Domains in SCOP 1.59: d1kpjc_
  • Chain 'D':
    Domains in SCOP 1.59: d1kpjd_
  • Chain 'E':
    Domains in SCOP 1.59: d1kpje_
  • Chain 'F':
    Domains in SCOP 1.59: d1kpjf_
  • Chain 'G':
    Domains in SCOP 1.59: d1kpjg_
  • Chain 'H':
    Domains in SCOP 1.59: d1kpjh_
  • Chain 'I':
    Domains in SCOP 1.59: d1kpji_
  • Chain 'J':
    Domains in SCOP 1.59: d1kpjj_
  • Chain 'K':
    Domains in SCOP 1.59: d1kpjk_
  • Chain 'L':
    Domains in SCOP 1.59: d1kpjl_
  • Chain 'M':
    Domains in SCOP 1.59: d1kpjm_
  • Chain 'N':
    Domains in SCOP 1.59: d1kpjn_
  • Chain 'O':
    Domains in SCOP 1.59: d1kpjo_
  • Chain 'P':
    Domains in SCOP 1.59: d1kpjp_
  • Chain 'Q':
    Domains in SCOP 1.59: d1kpjq_
  • Chain 'R':
    Domains in SCOP 1.59: d1kpjr_
  • Chain 'S':
    Domains in SCOP 1.59: d1kpjs_
  • Chain 'T':
    Domains in SCOP 1.59: d1kpjt_
  • Chain 'U':
    Domains in SCOP 1.59: d1kpju_
  • Chain 'V':
    Domains in SCOP 1.59: d1kpjv_
  • Chain 'W':
    Domains in SCOP 1.59: d1kpjw_
  • Chain 'X':
    Domains in SCOP 1.59: d1kpjx_
  • Chain 'Y':
    Domains in SCOP 1.59: d1kpjy_
  • Chain 'Z':
    Domains in SCOP 1.59: d1kpjz_

PDB Chain Sequences:

  • Chain '0':
    No sequence available.

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kpj1 (1:)
    akdgpriivkmessagtgfyytttknrrntqaklelkkydpvakkhvvfrekk
    

  • Chain '2':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kpj2 (2:)
    mkrtyqpnnrkrakthgfrarmktksgrnilarrrakgrhqltvsd
    

  • Chain '3':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kpj3 (3:)
    pkmkthkmakrrikitgtgkvmafksgkrhqntgksgdeirgkgkgfvlakaewarmklm
    lpr
    

  • Chain '4':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kpj4 (4:)
    kvrssvkkmcdnckvvrrhgrvlvicsnvkhkqrq
    

  • Chain '9':
    No sequence available.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kpjA (A:)
    kkyrpytpsrrqmttadfsgltkkrpekaltealpktggrnnrgritsrfiggghkrlyr
    iidfkrrdksgvnakvaaieydpnrsariallhyadgekryilapegltvgatvnagpea
    epklgnalplrfvpvgavvhalelvpgkgaqlarsagtsvqvqgkesdyvivrlpsgelr
    rvhsecyatigavgnaehknivlgkagrsrwlgrkphqrgsamnpvdhphgggegrtgag
    rvpvtpwgkptkglktrrkrktsdrfivtr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kpjB (B:)
    mkgilgtkigmtqiwkndraipvtvvlagpcpivqrktaqtdgyeavqigyapkaerkvn
    kpmqghfakagvaptrilrefrgfapdgdsvnvdifaegekidatgtskgkgtqgvmkrw
    nfaggpashgskkwhrrpgsigqrktpgrvykgkrmaghmgmervtvqnlevveiragen
    lilvkgaipgangglvvlrsaakas
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kpjC (C:)
    aqinvigqnggrtielplpevnsgvlhevvtwqlasrrrgtastrtraqvsktgrkmygq
    kgtgnarhgdrsvptfvgggvafgpkprsydytlprqvrqlglamaiasrqeggklvavd
    gfdiadaktknfiswakqngldgtekvllvtddentrraarnvswvsvlpvagvnvydil
    rhdrlvidaaaleivee
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kpjD (D:)
    qqlktkyndqvrpalmqqfgyssvmavpriekivvneglgsskedskaidkaakelalit
    lqkpiitkakksisnfklrqgmpvgikvtlrgermyvflekliniglprirdfrginpna
    fdgrgnynlgikeqlifpeitydmvdktrgmditivttaktdeearallqsmglpfrk
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kpjE (E:)
    gkqpiavpsgvtvnaqdgvfkvkgpkgeltvpynteltvrqdgdqllverpsdaqkhral
    hgltrtlvanavkgvsdgytinlelrgvgfrakltgkalemnigyshpviieppagvtfa
    vpeptridvsgidkqlvgqvaanvrkvrkpdayhgkgvrfvgeqialkagkagatgg
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kpjF (F:)
    mqvillepsrlgktgevvsvkdgyarnwlipqglavsatrtnmktleaqlrs
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kpjG (G:)
    mkkvagivklqlpagkatpappvgpalgqyganimeftkafnaqtadkgdaiipveitiy
    adrsftfitktppmsylirkaagigkgsstpnkakvgklnwdqvleiaktkmpdlnagsv
    eaaantvagtarsmgvtveggpn
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kpjH (H:)
    vktyipkndeqnwvvvdasgvplgrlatliasrirgkhrpdftpnmiqgdfvvvinaaqv
    altgkklddkvytrytgyqgglktetarealskhperviehavfgmlpkgrqgramhtrl
    kvyagethphsaqkpqvlktqpl
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kpjI (I:)
    impqsrldvadnsgareimcirvlnsgiggkglttggggnkryahvgdiivasvkdaapr
    gavkagdvvkavvvrtshaikradgstirfdrnaaviinnqgeprgtrvfgpvarelrdr
    rfmkivslapev
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kpjJ (J:)
    hdlkptpgsrkdrkrvgrgpggtdktagrghkgqksrsgagkgaffeggrsrliarlpkr
    gfnnvgttyevvklsqlqdledttfdrdtleayrlvrrknrpvkllasgeisravtvhvd
    aasaaaikaveaaggrvvlpe
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kpjK (K:)
    tkfrkqfrgrmtgdakggdyvafgdygliamepawiksnqieacrivmsrhfrrggkiyi
    rifpdkpvtkkpaetrmgkgkgaveywvsvvkpgrvmfevagvteeqakeafrlaghklp
    iqtk
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kpjL (L:)
    hgkagrklnrnssarvalaraqatallregriqttltkakelrpfveqlittakggdlhs
    rrlvaqdihdkdvvrkvmdevapkyaerpggytrilrvgtrrgdgvtmalielv
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kpjM (M:)
    attirrklrtrrkvrtttaasgrlrlsvyrsskhiyaqiiddsrgqtlaaassaalksgn
    ktdtaaavgkalaaaaaekgikqvvfdrgsykyhgrvkaladaareggldf
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kpjN (N:)
    qthikinrgellrgieqdhtrqlpdfrpgdtvrvdtkvregnrtrsqafegvviaingsg
    srksftvrkisfgegvervfpfasplvnqvtivergkvrraklyylrelrgkaariksdr
    srvmk
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kpjO (O:)
    praktgivrrrrhkkvlkrakgfwgsrskqyrnafqtllnaatyeyrdrrnkkrdfrrlw
    iqrinagarlhgmnystfinglkranidlnrkvladiaarepeafkalvdasrna
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kpjP (P:)
    mfaiiqtggkqyrvsegdvirveslqgeagdkvelkalfvggeqtvfgedagkytvqaev
    vehgrgkkiyirkyksgvqyrrrtghrqnftaikilgiqg
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kpjQ (Q:)
    eqtfrnkkqrkqqvklrkpgfavakyvrmsprkvrlvvdvirgksvqdaedllrfiprsa
    sepvakvlnsakanalhndemledrlfvkeayvdagptlkrliprargsaniikkrtshi
    tiivaekgnk
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kpjR (R:)
    shydilqapvisekaysamergvysfwvspkatkteikdaiqqafgvrvigistmnvpgk
    rkrvgrfigqrndrkkaivrlaegqsiealagq
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kpjS (S:)
    prpsagshhndklhfkkgdtvivlsgkhkgqtgkvllalprdqkvvvegvnvitknvkps
    mtnpqggqeqrelalhaskvalvdpetgkatrvrkqivdgkkvrvavasgkt
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kpjT (T:)
    meltakprtpkqkldesmiaavaynkennvsfaldrkafdrafrqqsttglfditvegge
    tfpalvkavqmdkrkrapihvdfymvtygepvevsvpvhttgrsqgevqgglvdivvhnl
    qivapgprripqelvvdvtkmnigdhitagdiklpegctlaadpeltvvsvlpprltaee
    leaevqaaqvaglvaagelseeaaeavlegdasleevkaease
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kpjU (U:)
    ahkkgvgsskngrdsnpkylgvkkfggevvkagnilvrqrgtkfkagqgvgmgrdhtlfa
    lsdgkvvfinkgkgarfisieaaqte
    

  • Chain 'V':
    No sequence available.

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kpjW (W:)
    kpsemrnlqatdfakeidarkkelmelrfqaaagqlaqphrvrqlrrevaqlntvkaela
    rkgeq
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kpjX (X:)
    mkiklvrsvigrpgnqvktvqalglrkigdsrevsdtpavrgmvktvkhllevqe
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kpjY (Y:)
    mqkdlhpkavpckiiyqgqvvmetmstrpeihvdvwsgvhpfwtgeerfldtegrvdkfn
    krfgdsyrrgskk
    

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kpjZ (Z:)
    akhpvpkkktskskrdmrrshhaltapnltecpqchgkklshhicpncgyydgrqvla