PDB entry 1kpi

View 1kpi on RCSB PDB site
Description: Crystal Structure of mycolic acid cyclopropane synthase CmaA2 complexed with SAH and DDDMAB
Class: transferase
Keywords: mixed alpha beta fold, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, TRANSFERASE
Deposited on 2001-12-30, released 2002-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.208
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cyclopropane-fatty-acyl-phospholipid synthase 2
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: cmaA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A5P0 (Start-301)
      • conflict (273)
    Domains in SCOPe 2.07: d1kpia_
  • Heterogens: CO3, SO4, SAH, 10A, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kpiA (A:)
    mtsqgdttsgtqlkppveavrshydksneffklwldpsmtyscayferpdmtleeaqyak
    rklaldklnlepgmtlldigcgwgstmrhavaeydvnvigltlsenqyahdkamfdevds
    prrkevriqgweefdepvdrivslgafehfadgagdagferydtffkkfynltpddgrml
    lhtitipdkeeaqelgltspmsllrfikfilteifpggrlprisqvdyyssnagwkvery
    hriganyvptlnawadalqahkdeaialkgqetcdiymhylrgcsdlfrdkytdvcqftl
    vk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kpiA (A:)
    qlkppveavrshydksneffklwldpsmtyscayferpdmtleeaqyakrklaldklnle
    pgmtlldigcgwgstmrhavaeydvnvigltlsenqyahdkamfdevdsprrkevriqgw
    eefdepvdrivslgafehfadgagdagferydtffkkfynltpddgrmllhtitipdkee
    aqelgltspmsllrfikfilteifpggrlprisqvdyyssnagwkveryhriganyvptl
    nawadalqahkdeaialkgqetcdiymhylrgcsdlfrdkytdvcqftlvk