PDB entry 1kpi

View 1kpi on RCSB PDB site
Description: Crystal Structure of mycolic acid cyclopropane synthase CmaA2 complexed with SAH and DDDMAB
Deposited on 2001-12-30, released 2002-01-11
The last revision prior to the SCOP 1.59 freeze date was dated 2002-01-11, with a file datestamp of 2002-01-11.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.208
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1kpia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kpiA (A:)
    qlkppveavrshydksneffklwldpsmtyscayferpdmtleeaqyakrklaldklnle
    pgmtlldigcgwgstmrhavaeydvnvigltlsenqyahdkamfdevdsprrkevriqgw
    eefdepvdrivslgafehfadgagdagferydtffkkfynltpddgrmllhtitipdkee
    aqelgltspmsllrfikfilteifpggrlprisqvdyyssnagwkveryhriganyvptl
    nawadalqahkdeaialkgqetcdiymhylrgcsdlfrdkytdvcqftlvk