PDB entry 1kph

View 1kph on RCSB PDB site
Description: Crystal Structure of mycolic acid cyclopropane synthase CmaA1 complexed with SAH and DDDMAB
Deposited on 2001-12-30, released 2002-01-11
The last revision prior to the SCOP 1.63 freeze date was dated 2002-04-08, with a file datestamp of 2002-04-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.194
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1kpha_
  • Chain 'B':
    Domains in SCOP 1.63: d1kphb_
  • Chain 'C':
    Domains in SCOP 1.63: d1kphc_
  • Chain 'D':
    Domains in SCOP 1.63: d1kphd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kphA (A:)
    lkphfanvqahydlsddffrlfldptqtyscayferddmtlqeaqiakidlalgklglqp
    gmtlldvgcgwgatmmravekydvnvvgltlsknqanhvqqlvansenlrskrvllagwe
    qfdepvdrivsigafehfgherydaffslahrllpadgvmllhtitglhpkeiherglpm
    sftfarflkfivteifpggrlpsipmvqecasangftvtrvqslqphyaktldlwsaalq
    ankgqaialqseevyerymkyltgcaemfrigyidvnqftcqk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kphB (B:)
    delkphfanvqahydlsddffrlfldptqtyscayferddmtlqeaqiakidlalgklgl
    qpgmtlldvgcgwgatmmravekydvnvvgltlsknqanhvqqlvansenlrskrvllag
    weqfdepvdrivsigafehfgherydaffslahrllpadgvmllhtitglhpkeihergl
    pmsftfarflkfivteifpggrlpsipmvqecasangftvtrvqslqphyaktldlwsaa
    lqankgqaialqseevyerymkyltgcaemfrigyidvnqftcqk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kphC (C:)
    delkphfanvqahydlsddffrlfldptqtyscayferddmtlqeaqiakidlalgklgl
    qpgmtlldvgcgwgatmmravekydvnvvgltlsknqanhvqqlvansenlrskrvllag
    weqfdepvdrivsigafehfgherydaffslahrllpadgvmllhtitglhpkeihergl
    pmsftfarflkfivteifpggrlpsipmvqecasangftvtrvqslqphyaktldlwsaa
    lqankgqaialqseevyerymkyltgcaemfrigyidvnqftcqk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kphD (D:)
    delkphfanvqahydlsddffrlfldptqtyscayferddmtlqeaqiakidlalgklgl
    qpgmtlldvgcgwgatmmravekydvnvvgltlsknqanhvqqlvansenlrskrvllag
    weqfdepvdrivsigafehfgherydaffslahrllpadgvmllhtitglhpkeihergl
    pmsftfarflkfivteifpggrlpsipmvqecasangftvtrvqslqphyaktldlwsaa
    lqankgqaialqseevyerymkyltgcaemfrigyidvnqftcqk