PDB entry 1kp9

View 1kp9 on RCSB PDB site
Description: Crystal structure of mycolic acid cyclopropane synthase CmaA1, apo-form
Deposited on 2001-12-30, released 2002-01-11
The last revision prior to the SCOP 1.63 freeze date was dated 2002-04-08, with a file datestamp of 2002-04-08.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: 0.2
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1kp9a_
  • Chain 'B':
    Domains in SCOP 1.63: d1kp9b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kp9A (A:)
    lsddffrlfldptqtyscayferddmtlqeaqiakidlalgklglqpgmtlldvgcgwga
    tmmravekydvnvvgltlsknqanhvqqlvansenlrskrvllagweqfdepvdrivsig
    afehfgherydaffslahrllpadgvmllhtitglhpkeiherglpmsftfarflkfivt
    eifpggrlpsipmvqecasangftvtrvqslqphyaktldlwsaalqankgqaialqsee
    vyerymkyltgcaemfrigyidvnqftcqk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kp9B (B:)
    lsddffrlfldptqtyscayferddmtlqeaqiakidlalgklglqpgmtlldvgcgwga
    tmmravekydvnvvgltlsknqanhvqqlvansenlrskrvllagweqfdepvdrivsig
    afehfgherydaffslahrllpadgvmllhtitglhpkeiherglpmsftfarflkfivt
    eifpggrlpsipmvqecasangftvtrvqslqphyaktldlwsaalqankgqaialqsee
    vyerymkyltgcaemfrigyidvnqftcqk