PDB entry 1kp9

View 1kp9 on RCSB PDB site
Description: Crystal structure of mycolic acid cyclopropane synthase CmaA1, apo-form
Class: transferase
Keywords: mixed alpha beta fold, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, TRANSFERASE
Deposited on 2001-12-30, released 2002-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: 0.2
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclopropane-fatty-acyl-phospholipid synthase 1
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: cmaA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kp9a_
  • Chain 'B':
    Compound: cyclopropane-fatty-acyl-phospholipid synthase 1
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: cmaA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kp9b_
  • Heterogens: ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kp9A (A:)
    mpdelkphfanvqahydlsddffrlfldptqtyscayferddmtlqeaqiakidlalgkl
    glqpgmtlldvgcgwgatmmravekydvnvvgltlsknqanhvqqlvansenlrskrvll
    agweqfdepvdrivsigafehfgherydaffslahrllpadgvmllhtitglhpkeiher
    glpmsftfarflkfivteifpggrlpsipmvqecasangftvtrvqslqphyaktldlws
    aalqankgqaialqseevyerymkyltgcaemfrigyidvnqftcqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kp9A (A:)
    lsddffrlfldptqtyscayferddmtlqeaqiakidlalgklglqpgmtlldvgcgwga
    tmmravekydvnvvgltlsknqanhvqqlvansenlrskrvllagweqfdepvdrivsig
    afehfgherydaffslahrllpadgvmllhtitglhpkeiherglpmsftfarflkfivt
    eifpggrlpsipmvqecasangftvtrvqslqphyaktldlwsaalqankgqaialqsee
    vyerymkyltgcaemfrigyidvnqftcqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kp9B (B:)
    mpdelkphfanvqahydlsddffrlfldptqtyscayferddmtlqeaqiakidlalgkl
    glqpgmtlldvgcgwgatmmravekydvnvvgltlsknqanhvqqlvansenlrskrvll
    agweqfdepvdrivsigafehfgherydaffslahrllpadgvmllhtitglhpkeiher
    glpmsftfarflkfivteifpggrlpsipmvqecasangftvtrvqslqphyaktldlws
    aalqankgqaialqseevyerymkyltgcaemfrigyidvnqftcqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kp9B (B:)
    lsddffrlfldptqtyscayferddmtlqeaqiakidlalgklglqpgmtlldvgcgwga
    tmmravekydvnvvgltlsknqanhvqqlvansenlrskrvllagweqfdepvdrivsig
    afehfgherydaffslahrllpadgvmllhtitglhpkeiherglpmsftfarflkfivt
    eifpggrlpsipmvqecasangftvtrvqslqphyaktldlwsaalqankgqaialqsee
    vyerymkyltgcaemfrigyidvnqftcqk