PDB entry 1koq

View 1koq on RCSB PDB site
Description: neisseria gonorrhoeae carbonic anhydrase
Class: lyase
Keywords: lyase, carbonic anhydrase, neisseria gonorrhoeae, structural trimming
Deposited on 1998-03-22, released 1998-12-09
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.206
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carbonic anhydrase
    Species: NEISSERIA GONORRHOEAE [TaxId:485]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1koqa_
  • Chain 'B':
    Compound: carbonic anhydrase
    Species: NEISSERIA GONORRHOEAE [TaxId:485]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1koqb_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1koqA (A:)
    hthwgytghdspeswgnlseefrlcstgknqspvnitetvsgklpaikvnykpsmvdven
    nghtiqvnypeggntltvngrtytlkqfhfhvpsenqikgrtfpmeahfvhldenkqplv
    lavlyeagktngrlssiwnvmpmtagkvklnqpfdastllpkrlkyyrfagslttppcte
    gvswlvlktydhidqaqaekftravgsennrpvqplnarvvie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1koqA (A:)
    thwgytghdspeswgnlseefrlcstgknqspvnitetvsgklpaikvnykpsmvdvenn
    ghtiqvnypeggntltvngrtytlkqfhfhvpsenqikgrtfpmeahfvhldenkqplvl
    avlyeagktngrlssiwnvmpmtagkvklnqpfdastllpkrlkyyrfagslttppcteg
    vswlvlktydhidqaqaekftravgsennrpvqplnarvvie
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1koqB (B:)
    hthwgytghdspeswgnlseefrlcstgknqspvnitetvsgklpaikvnykpsmvdven
    nghtiqvnypeggntltvngrtytlkqfhfhvpsenqikgrtfpmeahfvhldenkqplv
    lavlyeagktngrlssiwnvmpmtagkvklnqpfdastllpkrlkyyrfagslttppcte
    gvswlvlktydhidqaqaekftravgsennrpvqplnarvvie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1koqB (B:)
    hwgytghdspeswgnlseefrlcstgknqspvnitetvsgklpaikvnykpsmvdvenng
    htiqvnypeggntltvngrtytlkqfhfhvpsenqikgrtfpmeahfvhldenkqplvla
    vlyeagktngrlssiwnvmpmtagkvklnqpfdastllpkrlkyyrfagslttppctegv
    swlvlktydhidqaqaekftravgsennrpvqplnarvvie