PDB entry 1koa

View 1koa on RCSB PDB site
Description: twitchin kinase fragment (c.elegans), autoregulated protein kinase and immunoglobulin domains
Class: kinase
Keywords: kinase, twitchin, intrasteric regulation
Deposited on 1996-06-28, released 1997-03-12
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.251
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: twitchin
    Species: Caenorhabditis elegans [TaxId:6239]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1koaa1, d1koaa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1koaA (A:)
    rkrrrgydvdeqgkivrgkgtvssnydnyvfdiwkqyypqpveikhdhvldhydiheelg
    tgafgvvhrvteratgnnfaakfvmtphesdketvrkeiqtmsvlrhptlvnlhdafedd
    nemvmiyefmsggelfekvadehnkmsedeaveymrqvckglchmhennyvhldlkpeni
    mfttkrsnelklidfgltahldpkqsvkvttgtaefaapevaegkpvgyytdmwsvgvls
    yillsglspfggenddetlrnvkscdwnmddsafsgisedgkdfirkllladpntrmtih
    qalehpwltpgnapgrdsqipssrytkirdsiktkydawpeplpplgrisnysslrkhrp
    qeysirdafwdrseaqprfivkpygtevgegqsanfycrviassppvvtwhkddrelkqs
    vkymkryngndygltinrvkgddkgeytvraknsygtkeeivflnvtrhseplkfeplep
    mkkapspprve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1koaA (A:)
    ydnyvfdiwkqyypqpveikhdhvldhydiheelgtgafgvvhrvteratgnnfaakfvm
    tphesdketvrkeiqtmsvlrhptlvnlhdafeddnemvmiyefmsggelfekvadehnk
    msedeaveymrqvckglchmhennyvhldlkpenimfttkrsnelklidfgltahldpkq
    svkvttgtaefaapevaegkpvgyytdmwsvgvlsyillsglspfggenddetlrnvksc
    dwnmddsafsgisedgkdfirkllladpntrmtihqalehpwltpgnapgrdsqipssry
    tkirdsiktkydawpeplpplgrisnysslrkhrpqeysirdafwdrseaqprfivkpyg
    tevgegqsanfycrviassppvvtwhkddrelkqsvkymkryngndygltinrvkgddkg
    eytvraknsygtkeeivflnvtrhsep