PDB entry 1ko0

View 1ko0 on RCSB PDB site
Description: Crystal Structure of a D,L-lysine complex of diaminopimelate decarboxylase
Class: lyase
Keywords: pyridoxal-5'-phosphate, diaminopimelate, lysine, PLP, TIM-barrel, LYASE
Deposited on 2001-12-19, released 2003-11-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.181
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: diaminopimelate decarboxylase
    Species: Escherichia coli [TaxId:562]
    Gene: LysA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ko0a1, d1ko0a2
  • Heterogens: PLP, LYS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ko0A (A:)
    mphslfstdtdltaenllrlpaefgcpvwvydaqiirrqiaalkqfdvvrfaqkacsnih
    ilrlmreqgvkvdsvslgeieralaagynpqthpddivftadvidqatlervselqipvn
    agsvdmldqlgqvspghrvwlrvnpgfghghsqktntggenskhgiwytdlpaaldviqr
    hhlqlvgihmhigsgvdyahleqvcgamvrqviefgqdlqaisaggglsvpyqqgeeavd
    tehyyglwnaareqiarhlghpvkleiepgrflvaqsgvlitqvrsvkqmgsrhfvlvda
    gfndlmrpamygsyhhisalaadgrslehaptvetvvagplcesgdvftqqeggnvetra
    lpevkagdylvlhdtgaygasmssnynsrpllpevlfdngqarlirrrqtieellalell
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ko0A (A:)
    phslfstdtdltaenllrlpaefgcpvwvydaqiirrqiaalkqfdvvrfaqkacsnihi
    lrlmreqgvkvdsvslgeieralaagynpqthpddivftadvidqatlervselqipvna
    gsvdmldqlgqvspghrvwlrvnpgfghghsqktntggenskhgiwytdlpaaldviqrh
    hlqlvgihmhigsgvdyahleqvcgamvrqviefgqdlqaisaggglsvpyqqgeeavdt
    ehyyglwnaareqiarhlghpvkleiepgrflvaqsgvlitqvrsvkqmgsrhfvlvdag
    fndlmrpamygsyhhisalaadgrslehaptvetvvagplcesgdvftqqeggnvetral
    pevkagdylvlhdtgaygasmssnynsrpllpevlfdngqarlirrrqtieellalell