PDB entry 1knw

View 1knw on RCSB PDB site
Description: Crystal structure of diaminopimelate decarboxylase
Deposited on 2001-12-19, released 2003-11-11
The last revision prior to the SCOP 1.69 freeze date was dated 2003-11-11, with a file datestamp of 2003-11-11.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.173
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1knwA (A:)
    mphslfstdtdltaenllrlpaefgcpvwvydaqiirrqiaalkqfdvvrfaqkacsnih
    ilrlmreqgvkvdsvslgeieralaagynpqthpddivftadvidqatlervselqipvn
    agsvdmldqlgqvspghrvwlrvnpgfghghsqktntggenskhgiwytdlpaaldviqr
    hhlqlvgihmhigsgvdyahleqvcgamvrqviefgqdlqaisaggglsvpyqqgeeavd
    tehyyglwnaareqiarhlghpvkleiepgrflvaqsgvlitqvrsvkqmgsrhfvlvda
    gfndlmrpamygsyhhisalaadgrslehaptvetvvagplcesgdvftqqeggnvetra
    lpevkagdylvlhdtgaygasmssnynsrpllpevlfdngqarlirrrqtieellalell
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1knwA (A:)
    phslfstdtdltaenllrlpaefgcpvwvydaqiirrqiaalkqfdvvrfaqkacsnihi
    lrlmreqgvkvdsvslgeieralaagynpqthpddivftadvidqatlervselqipvna
    gsvdmldqlgqvspghrvwlrvnpgfghghsqktntggenskhgiwytdlpaaldviqrh
    hlqlvgihmhigsgvdyahleqvcgamvrqviefgqdlqaisaggglsvpyqqgeeavdt
    ehyyglwnaareqiarhlghpvkleiepgrflvaqsgvlitqvrsvkqmgsrhfvlvdag
    fndlmrpamygsyhhisalaadgrslehaptvetvvagplcesgdvftqqeggnvetral
    pevkagdylvlhdtgaygasmssnynsrpllpevlfdngqarlirrrqtieellalellh
    h