PDB entry 1knb

View 1knb on RCSB PDB site
Description: crystal structure of the receptor-binding domain of adenovirus type 5 fiber protein at 1.7 angstroms resolution
Deposited on 1995-01-06, released 1995-03-31
The last revision prior to the SCOP 1.59 freeze date was dated 1995-03-31, with a file datestamp of 1995-03-26.
Experiment type: -
Resolution: 1.7 Å
R-factor: 0.158
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1knb__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1knb_ (-)
    ndkltlwttpapspncrlnaekdakltlvltkcgsqilatvsvlavkgslapisgtvqsa
    hliirfdengvllnnsfldpeywnfrngdltegtaytnavgfmpnlsaypkshgktaksn
    ivsqvylngdktkpvtltitlngtqetgdttpsaysmsfswdwsghnyineifatssytf
    syiaqe