PDB entry 1kna

View 1kna on RCSB PDB site
Description: chromo domain of hp1 complexed with histone h3 tail containing dimethyllysine 9.
Deposited on 2001-12-18, released 2002-03-20
The last revision prior to the SCOP 1.61 freeze date was dated 2002-03-20, with a file datestamp of 2002-03-20.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.228
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1knaa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1knaA (A:)
    eyavekiidrrvrkgmveyylkwkgypetentwepennldcqdliqqyeasr