PDB entry 1kn1

View 1kn1 on RCSB PDB site
Description: Crystal structure of allophycocyanin
Class: electron transport
Keywords: helix-turn-helix, ELECTRON TRANSPORT
Deposited on 2001-12-18, released 2002-12-18
The last revision prior to the SCOP 1.75 freeze date was dated 2008-10-07, with a file datestamp of 2008-10-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.193
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: allophycocyanin
    Species: Porphyra yezoensis [TaxId:2788]
    Database cross-references and differences (RAF-indexed):
    • PDB 1KN1 (0-159)
    Domains in SCOP 1.75: d1kn1a_
  • Chain 'B':
    Compound: allophycocyanin
    Species: Porphyra yezoensis [TaxId:2788]
    Database cross-references and differences (RAF-indexed):
    • PDB 1KN1 (0-160)
    Domains in SCOP 1.75: d1kn1b_
  • Heterogens: CYC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kn1A (A:)
    sivtksivnadaearylspgeldriksfvlsgarrvriaqtltenrerivkqagdqlfqk
    rpdvvspggnaygeemtatclrdldyylrlvtygivsgdvtpieeiglvgvremykslgt
    pisavaegvkcmksvassllsgedsaeagfyfdyvvgamq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kn1B (B:)
    mqdaitsvinssdvqgkyldssaieklkgyfqtgelrvraattiaanaaniikeavaksl
    lysditrpggnmyttrryaacirdldyylryatyamlagdpsildervlnglketynslg
    vpigatiqaiqamkevtsglvgpdagkemglyfdyicsgls