PDB entry 1kmq

View 1kmq on RCSB PDB site
Description: Crystal Structure of a Constitutively Activated RhoA Mutant (Q63L)
Class: signaling protein
Keywords: GTPase, constitutive mutant, GTP-analog, SIGNALING PROTEIN
Deposited on 2001-12-17, released 2003-05-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.163
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transforming protein rhoa
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61586 (6-End)
      • engineered (27)
      • engineered (65)
    Domains in SCOPe 2.07: d1kmqa_
  • Heterogens: MG, GNP, DIO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kmqA (A:)
    gamgspirkklvivgdgacgktcllivnskdqfpevyvptvfenyvadievdgkqvelal
    wdtagledydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgn
    kkdlrndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematra
    alqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kmqA (A:)
    irkklvivgdgacgktcllivnskdqfpevyvptvfenyvadievdgkqvelalwdtagl
    edydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlrn
    dehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalq