PDB entry 1kmj

View 1kmj on RCSB PDB site
Description: E. coli NifS/CsdB protein at 2.0A with the cysteine persulfide intermediate (residue CSS).
Class: lyase
Keywords: persulfide perselenide nifs pyridoxal phosphate, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, LYASE
Deposited on 2001-12-16, released 2001-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-23, with a file datestamp of 2013-10-18.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.178
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: selenocysteine lyase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77444 (Start-405)
      • modified residue (363)
    Domains in SCOPe 2.07: d1kmja_
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kmjA (A:)
    mifsvdkvradfpvlsrevnglplayldsaasaqkpsqvidaeaefyrhgyaavhrgiht
    lsaqatekmenvrkraslfinarsaeelvfvrgtteginlvanswgnsnvragdniiisq
    mehhanivpwqmlcarvgaelrviplnpdgtlqletlptlfdektrllaithvsnvlgte
    nplaemitlahqhgakvlvdgaqavmhhpvdvqaldcdfyvfsghklygptgigilyvke
    allqemppwegggsmiatvslsegttwtkapwrfeagtpntggiiglgaaleyvsalgln
    niaeyeqnlmhyalsqlesvpdltlygpqnrlgviafnlgkhhaydvgsfldnygiavrt
    ghhcamplmayynvpamcraslamyntheevdrlvtglqrihrllg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kmjA (A:)
    ifsvdkvradfpvlsrevnglplayldsaasaqkpsqvidaeaefyrhgyaavhrgihtl
    saqatekmenvrkraslfinarsaeelvfvrgtteginlvanswgnsnvragdniiisqm
    ehhanivpwqmlcarvgaelrviplnpdgtlqletlptlfdektrllaithvsnvlgten
    plaemitlahqhgakvlvdgaqavmhhpvdvqaldcdfyvfsghklygptgigilyvkea
    llqemppwegggsmiatvslsegttwtkapwrfeagtpntggiiglgaaleyvsalglnn
    iaeyeqnlmhyalsqlesvpdltlygpqnrlgviafnlgkhhaydvgsfldnygiavrtg
    hhcamplmayynvpamcraslamyntheevdrlvtglqrihrllg