PDB entry 1kmh

View 1kmh on RCSB PDB site
Description: Crystal Structure of spinach chloroplast F1-ATPase complexed with tentoxin
Deposited on 2001-12-16, released 2002-03-13
The last revision prior to the SCOP 1.63 freeze date was dated 2002-03-13, with a file datestamp of 2002-03-13.
Experiment type: XRAY
Resolution: 3.4 Å
R-factor: 0.298
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kmhA (A:)
    kvvntgtvlqvgdgiarihgldevmagelvefeegtigialnlesnnvgvvlmgdglmiq
    egssvkatgriaqipvseaylgrvinalakpidgrgeitasesrliespapgimsrrsvy
    eplqtgliaidamipvgrgqreliigdrqtgktavatdtilnqqgqnvicvyvaigqkas
    svaqvvtnfqergameytivvaetadspatlqylapytgaalaeyfmyrerhtliiyddl
    skqaqayrqmslllrrppgreaypgdvfylhsrlleraaklssllgegsmtalpivetqa
    gdvsayiptnvisitdgqiflsadlfnagirpainvgisvsrvgsaaqikamkkvagklk
    lelaqfaeleafaqfasdldkatqnqlargqrlrellkqpqsapltveeqvmtiytgtng
    yldsleldqvrkylvelrtyvktnkpefqeiisstktfteeaeallkeaiqeqmerf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kmhB (B:)
    nlgriaqiigpvlnvafppgkmpniynalivkgrdtagqpmnvtcevqqllgnnrvrava
    msatdgltrgmevidtgaplsvpvggptlgrifnvlgepvdnlrpvdtrttspihrsapa
    ftqldtklsifetgikvvnllapyrrggkiglfggagvgktvlimelinniakahggvsv
    fggvgertregndlymemkesgvineqniaeskvalvygqmneppgarmrvgltaltmae
    yfrdvneqdvllfidnifrfvqagsevsallgrmpsavgyqptlstemgslqeritstke
    gsitsiqavyvpaddltdpapattfahldattvlsrglaakgiypavdpldststmlqpr
    ivgeehyeiaqrvketlqrykelqdiiailgldelseedrltvararkierflsqpffva
    evftgspgkyvglaetirgfqlilsgeldslpeqafylvgnideata