PDB entry 1kmg

View 1kmg on RCSB PDB site
Description: The Solution Structure Of Monomeric Copper-free Superoxide Dismutase
Class: oxidoreductase
Keywords: oxidoreductase, superoxide dismutase, NMR, copper-free protein, beta-barrel
Deposited on 2001-12-15, released 2002-10-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -1.98 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered (5)
      • engineered (49-50)
      • engineered (110)
      • engineered (132)
    Domains in SCOPe 2.07: d1kmga_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kmgA (A:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvheeedntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
    ekaddlgkggneqstktgnagsrlacgvigiaq