PDB entry 1klu

View 1klu on RCSB PDB site
Description: Crystal structure of HLA-DR1/TPI(23-37) complexed with staphylococcal enterotoxin C3 variant 3B2 (SEC3-3B2)
Deposited on 2001-12-12, released 2002-08-02
The last revision prior to the SCOP 1.65 freeze date was dated 2002-08-14, with a file datestamp of 2002-08-14.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.208
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kluA (A:)
    ehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalani
    avdkanleimtkrsnytpitnvppevtvltnspvelrepnvlicfidkftppvvnvtwlr
    ngkpvttgvsetvflpredhlfrkfhylpflpstedvydcrvehwgldepllkhwefda
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kluB (B:)
    gdtrprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaey
    wnsqkdlleqrraavdtycrhnygvgesftvqrrvepkvtvypsktqplqhhnllvcsvs
    gfypgsievrwfrngqeekagvvstgliqngdwtfqtlvmletvprsgevytcqvehpsv
    tspltvewra
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1kluD (D:)
    esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdsffkwdliynisdkklkn
    ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnvgkvtggktcmyggitkheg
    nhfdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnssp
    yetgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kluD (D:)
    esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdsffkwdliynisdkklkn
    ydkvktellnedlakkykdevvdvygsnyyvncyfsggktcmyggitkhegnhfdngnlq
    nvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspyetgyikfi
    enngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng