PDB entry 1kl7

View 1kl7 on RCSB PDB site
Description: Crystal Structure of Threonine Synthase from Yeast
Class: lyase
Keywords: threonine synthesis, pyridoxal 5-phosphate, beta-family, monomer, LYASE
Deposited on 2001-12-11, released 2002-04-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.201
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: threonine synthase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16120
      • modified residue (65)
      • modified residue (196)
      • modified residue (250)
      • modified residue (290)
      • modified residue (330)
      • modified residue (511)
    Domains in SCOPe 2.07: d1kl7a_
  • Chain 'B':
    Compound: threonine synthase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16120
      • modified residue (65)
      • modified residue (196)
      • modified residue (250)
      • modified residue (290)
      • modified residue (330)
      • modified residue (511)
    Domains in SCOPe 2.07: d1kl7b_
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kl7A (A:)
    mpnasqvyrstrssspktisfeeaiiqglatdgglfipptipqvdqatlfndwsklsfqd
    lafaimrlyiaqeeipdadlkdlikrsystfrsdevtplvqnvtgdkenlhilelfhgpt
    yafkdvalqfvgnlfeyflqrtnanlpegekkqitvvgatsgdtgsaaiyglrgkkdvsv
    filyptgrispiqeeqmttvpdenvqtlsvtgtfdncqdivkaifgdkefnskhnvgavn
    sinwarilaqmtyyfysffqatngkdskkvkfvvpsgnfgdilagyfakkmglpieklai
    atnendildrflksglyersdkvaatlspamdilissnferllwylareylangddlkag
    eivnnwfqelktngkfqvdksiiegaskdftservsneetsetikkiyessvnpkhyild
    phtavgvcaterliakdndksiqyislstahpakfadavnnalsgfsnysfekdvlpeel
    kklstlkkklkfieradvelvknaieeelakmkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kl7A (A:)
    pnasqvyrstrssspktisfeeaiiqglatdgglfipptipqvdqatlfndwsklsfqdl
    afaimrlyiaqeeipdadlkdlikrsystfrsdevtplvqnvtgdkenlhilelfhgpty
    afkdvalqfvgnlfeyflqrtnanlpegekkqitvvgatsgdtgsaaiyglrgkkdvsvf
    ilyptgrispiqeeqmttvpdenvqtlsvtgtfdncqdivkaifgdkefnhnvgavnsin
    warilaqmtyyfysffqatngkdskkvkfvvpsgnfgdilagyfakkmglpieklaiatn
    endildrflksglyersdkvaatlspamdilissnferllwylareylangddlkageiv
    nnwfqelktngkfqvdksiiegaskdftservsneetsetikkiyessvnpkhyildpht
    avgvcaterliakdndksiqyislstahpakfadavnnalsgfsnysfekdvlpeelkkl
    stlkkklkfieradvelvknaieeelakm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kl7B (B:)
    mpnasqvyrstrssspktisfeeaiiqglatdgglfipptipqvdqatlfndwsklsfqd
    lafaimrlyiaqeeipdadlkdlikrsystfrsdevtplvqnvtgdkenlhilelfhgpt
    yafkdvalqfvgnlfeyflqrtnanlpegekkqitvvgatsgdtgsaaiyglrgkkdvsv
    filyptgrispiqeeqmttvpdenvqtlsvtgtfdncqdivkaifgdkefnskhnvgavn
    sinwarilaqmtyyfysffqatngkdskkvkfvvpsgnfgdilagyfakkmglpieklai
    atnendildrflksglyersdkvaatlspamdilissnferllwylareylangddlkag
    eivnnwfqelktngkfqvdksiiegaskdftservsneetsetikkiyessvnpkhyild
    phtavgvcaterliakdndksiqyislstahpakfadavnnalsgfsnysfekdvlpeel
    kklstlkkklkfieradvelvknaieeelakmkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kl7B (B:)
    pnasqvyrstrssspktisfeeaiiqglatdgglfipptipqvdqatlfndwsklsfqdl
    afaimrlyiaqeeipdadlkdlikrsystfrsdevtplvqnvtgdkenlhilelfhgpty
    afkdvalqfvgnlfeyflqrtnanlpegekkqitvvgatsgdtgsaaiyglrgkkdvsvf
    ilyptgrispiqeeqmttvpdenvqtlsvtgtfdncqdivkaifgdkefnhnvgavnsin
    warilaqmtyyfysffqatngkdskkvkfvvpsgnfgdilagyfakkmglpieklaiatn
    endildrflksglyersdkvaatlspamdilissnferllwylareylangddlkageiv
    nnwfqelktngkfqvdksiiegaskdftservsneetsetikkiyessvnpkhyildpht
    avgvcaterliakdndksiqyislstahpakfadavnnalsgfsnysfekdvlpeelkkl
    stlkkklkfieradvelvknaieeelakm