PDB entry 1kl4

View 1kl4 on RCSB PDB site
Description: AN ENGINEERED STREPTAVIDIN WITH IMPROVED AFFINITY FOR THE STREP-TAG II PEPTIDE : apo-SAM2
Class: peptide binding protein
Keywords: biotin, crystal structure, protein engineering, strep-tag, streptavidin, peptide binding protein
Deposited on 2001-12-11, released 2002-04-03
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.193
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629
      • engineered (31-32)
      • engineered (34)
    Domains in SCOPe 2.03: d1kl4a_
  • Chain 'B':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629
      • engineered (31-32)
      • engineered (34)
    Domains in SCOPe 2.03: d1kl4b_
  • Chain 'C':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629
      • engineered (31-32)
      • engineered (34)
    Domains in SCOPe 2.03: d1kl4c_
  • Chain 'D':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629
      • engineered (31-32)
      • engineered (34)
    Domains in SCOPe 2.03: d1kl4d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kl4A (A:)
    meagitgtwynqlgstfivtagadgaltgtyigargnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
    vkpsaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kl4A (A:)
    gitgtwynqlgstfivtagadgaltgtyigargnaesryvltgrydsapatdgsgtalgw
    tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvkp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kl4B (B:)
    meagitgtwynqlgstfivtagadgaltgtyigargnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
    vkpsaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kl4B (B:)
    agitgtwynqlgstfivtagadgaltgtyigargnaesryvltgrydsapatdgsgtalg
    wtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1kl4C (C:)
    meagitgtwynqlgstfivtagadgaltgtyigargnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
    vkpsaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kl4C (C:)
    gitgtwynqlgstfivtagadgaltgtyigargnaesryvltgrydsapatdgsgtalgw
    tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1kl4D (D:)
    meagitgtwynqlgstfivtagadgaltgtyigargnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
    vkpsaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kl4D (D:)
    gitgtwynqlgstfivtagadgaltgtyigargnaesryvltgrydsapatdgsgtalgw
    tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk