PDB entry 1kkm

View 1kkm on RCSB PDB site
Description: L.casei HprK/P in complex with B.subtilis P-Ser-HPr
Class: transferase,hydrolase/transport protein
Keywords: phosphorylation, protein kinase, bacteria, protein/protein interaction, phosphoserine, TRANSFERASE, HYDROLASE/TRANSPORT PROTEIN COMPLEX, TRANSFERASE,HYDROLASE/TRANSPORT PROTEIN COMPLEX
Deposited on 2001-12-10, released 2002-08-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.2
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hprk protein
    Species: Lactobacillus casei [TaxId:1582]
    Gene: PTSK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1kkma_
  • Chain 'B':
    Compound: hprk protein
    Species: Lactobacillus casei [TaxId:1582]
    Gene: PTSK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1kkmb_
  • Chain 'C':
    Compound: hprk protein
    Species: Lactobacillus casei [TaxId:1582]
    Gene: PTSK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1kkmc_
  • Chain 'H':
    Compound: Phosphocarrier protein HPr
    Species: Bacillus subtilis [TaxId:1423]
    Gene: PTSH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08877 (Start-99)
      • modified residue (57)
      • engineered (96)
    Domains in SCOPe 2.08: d1kkmh_
  • Chain 'I':
    Compound: Phosphocarrier protein HPr
    Species: Bacillus subtilis [TaxId:1423]
    Gene: PTSH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08877 (Start-99)
      • modified residue (57)
      • engineered (96)
    Domains in SCOPe 2.08: d1kkmi_
  • Chain 'J':
    Compound: Phosphocarrier protein HPr
    Species: Bacillus subtilis [TaxId:1423]
    Gene: PTSH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08877 (Start-99)
      • modified residue (57)
      • engineered (96)
    Domains in SCOPe 2.08: d1kkmj_
  • Heterogens: CA, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kkmA (A:)
    mrgshhhhhhgsmyldsqlaerrsmhgvlvdiyglgvlitgdsgvgksetalelvqrghr
    liaddrvdvyqqdeqtivgaappilshlleirglgiidvmnlfgagavredttislivhl
    enwtpdktfdrlgsgeqtqlifdvpvpkitvpvkvgrnlaiiievaamnfraksmgydat
    ktfeknlnhliehneetdqnssgdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kkmA (A:)
    errsmhgvlvdiyglgvlitgdsgvgksetalelvqrghrliaddrvdvyqqdeqtivga
    appilshlleirglgiidvmnlfgagavredttislivhlenwtpdktfdrlgsgeqtql
    ifdvpvpkitvpvkvgrnlaiiievaamnfraksmgydatktfeknlnhliehnee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kkmB (B:)
    mrgshhhhhhgsmyldsqlaerrsmhgvlvdiyglgvlitgdsgvgksetalelvqrghr
    liaddrvdvyqqdeqtivgaappilshlleirglgiidvmnlfgagavredttislivhl
    enwtpdktfdrlgsgeqtqlifdvpvpkitvpvkvgrnlaiiievaamnfraksmgydat
    ktfeknlnhliehneetdqnssgdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kkmB (B:)
    errsmhgvlvdiyglgvlitgdsgvgksetalelvqrghrliaddrvdvyqqdeqtivga
    appilshlleirglgiidvmnlfgagavredttislivhlenwtpdktfdrlgsgeqtql
    ifdvpvpkitvpvkvgrnlaiiievaamnfraksmgydatktfeknlnhliehneet
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1kkmC (C:)
    mrgshhhhhhgsmyldsqlaerrsmhgvlvdiyglgvlitgdsgvgksetalelvqrghr
    liaddrvdvyqqdeqtivgaappilshlleirglgiidvmnlfgagavredttislivhl
    enwtpdktfdrlgsgeqtqlifdvpvpkitvpvkvgrnlaiiievaamnfraksmgydat
    ktfeknlnhliehneetdqnssgdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kkmC (C:)
    rrsmhgvlvdiyglgvlitgdsgvgksetalelvqrghrliaddrvdvyqqdeqtivgaa
    ppilshlleirglgiidvmnlfgagavredttislivhlenwtpdktfdrlgsgeqtqli
    fdvpvpkitvpvkvgrnlaiiievaamnfraksmgydatktfeknlnhliehnee
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1kkmH (H:)
    mrgshhhhhhgsmaqktfkvtadsgiharpatvlvqtaskydadvnleyngktvnlksim
    gvmslgiakgaeitisasgadendalnaleetmkserlge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kkmH (H:)
    aqktfkvtadsgiharpatvlvqtaskydadvnleyngktvnlksimgvmslgiakgaei
    tisasgadendalnaleetmkserlge
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1kkmI (I:)
    mrgshhhhhhgsmaqktfkvtadsgiharpatvlvqtaskydadvnleyngktvnlksim
    gvmslgiakgaeitisasgadendalnaleetmkserlge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kkmI (I:)
    aqktfkvtadsgiharpatvlvqtaskydadvnleyngktvnlksimgvmslgiakgaei
    tisasgadendalnaleetmkserlge
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1kkmJ (J:)
    mrgshhhhhhgsmaqktfkvtadsgiharpatvlvqtaskydadvnleyngktvnlksim
    gvmslgiakgaeitisasgadendalnaleetmkserlge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kkmJ (J:)
    aqktfkvtadsgiharpatvlvqtaskydadvnleyngktvnlksimgvmslgiakgaei
    tisasgadendalnaleetmkserlge