PDB entry 1kkg

View 1kkg on RCSB PDB site
Description: NMR Structure of Ribosome-Binding Factor A (RbfA)
Deposited on 2001-12-07, released 2003-03-18
The last revision prior to the SCOP 1.65 freeze date was dated 2003-03-18, with a file datestamp of 2003-03-18.
Experiment type: NMR16
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1kkga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kkgA (A:)
    makefgrpqrvaqemqkeialilqreikdprlgmmttvsgvemsrdlayakvyvtflndk
    dedavkagikalqeasgfirsllgkamrlrivpeltffydnslvegmr