PDB entry 1kk2

View 1kk2 on RCSB PDB site
Description: Structure of the large gamma subunit of initiation factor eIF2 from Pyrococcus abyssi-G235D mutant complexed with GDP-Mg2+
Deposited on 2001-12-06, released 2002-04-10
The last revision prior to the SCOP 1.61 freeze date was dated 2002-04-10, with a file datestamp of 2002-04-10.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.219
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kk2A (A:)
    srqaevnigmvghvdhgkttltkaltgvwtdthseelrrgitikigfadaeirrcpncgr
    ystspvcpycghetefvrrvsfidapghealmttmlagaslmdgailviaanepcprpqt
    rehlmalqiigqkniiiaqnkielvdkekalenyrqikefiegtvaenapiipisalhga
    nidvlvkaiedfiptpkrdpnkppkmlvlrsfdvnkpgtppeklvggvldgsivqgklkv
    gdeieirpgvpyeehgrikyepitteivslqaggqfveeaypgglvgvgtkldpyltkgd
    lmagnvvgkpgklppvwdslrlevhllervvgteqelkvepikrkevlllnvgtartmgl
    vtglgkdeievklqipvcaepgdrvaisrqigsrwrligygiike
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kk2A (A:)
    srqaevnigmvghvdhgkttltkaltgvwtdseelrrgitikigfadaeirrcpncgrys
    tspvcpycghetefvrrvsfidapghealmttmlagaslmdgailviaanepcprpqtre
    hlmalqiigqkniiiaqnkielvdkekalenyrqikefiegtvaenapiipisalhgani
    dvlvkaiedfiptpkrdpnkppkmlvlrsfdvnkpglvggvldgsivqgklkvgdeieir
    pgvpyeehgrikyepitteivslqaggqfveeaypgglvgvgtkldpyltkgdlmagnvv
    gkpgklppvwdslrlevhllervveqelkvepikrkevlllnvgtartmglvtglgkdei
    evklqipvcaepgdrvaisrqigsrwrligygiike