PDB entry 1kj7
View 1kj7 on RCSB PDB site
Description: substrate shape determines specificity of recognition recognition for hiv-1 protease: analysis of crystal structures of six substrate complexes
Class: hydrolase
Keywords: p2-Nucleocapsid, SUBSTRATE RECOGNITION
Deposited on
2001-12-04, released
2002-03-06
The last revision prior to the SCOP 1.73 freeze date was dated
2003-04-01, with a file datestamp of
2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.206
AEROSPACI score: 0.44
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Pol polyprotein
Species: Human immunodeficiency virus 1
Gene: pol
Database cross-references and differences (RAF-indexed):
- Uniprot P03369 (0-98)
- engineered (6)
- engineered (24)
Domains in SCOP 1.73: d1kj7a_ - Chain 'B':
Compound: Pol polyprotein
Species: Human immunodeficiency virus 1
Gene: pol
Database cross-references and differences (RAF-indexed):
- Uniprot P03369 (0-98)
- engineered (6)
- engineered (24)
Domains in SCOP 1.73: d1kj7b_ - Chain 'P':
Compound: gag polyprotein
Database cross-references and differences (RAF-indexed):
- Heterogens: ACT, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1kj7A (A:)
pqitlwkrplvtiriggqlkeallntgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpvniigrnlltqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1kj7B (B:)
pqitlwkrplvtiriggqlkeallntgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpvniigrnlltqigctlnf
- Chain 'P':
No sequence available.