PDB entry 1kj3

View 1kj3 on RCSB PDB site
Description:
Deposited on 2001-12-04, released 2002-03-27
The last revision prior to the SCOP 1.65 freeze date was dated 2002-03-27, with a file datestamp of 2002-03-27.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.211
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1kj3h1, d1kj3h2
  • Chain 'I':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1kj3i1, d1kj3i2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1kj3l_
  • Chain 'M':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1kj3m_

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kj3H (H:)
    mgphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpey
    weretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyayd
    gcdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatl
    lrtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdg
    tfqkwasvvvplgkeqyytchvyhqglpepltlrweppp
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1kj3I (I:)
    mgphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpey
    weretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyayd
    gcdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatl
    lrtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdg
    tfqkwasvvvplgkeqyytchvyhqglpepltlrweppp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kj3I (I:)
    gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
    eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
    cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
    rtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgt
    fqkwasvvvplgkeqyytchvyhqglpepltlrweppp
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kj3L (L:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kj3M (M:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm