PDB entry 1kj2

View 1kj2 on RCSB PDB site
Description: Murine Alloreactive ScFv TCR-Peptide-MHC Class I Molecule Complex
Class: immune system
Keywords: t cell receptor, class I MHC, h-2kb, tcr-pmhc complex, allogeneic, immune system
Deposited on 2001-12-04, released 2002-03-27
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.71 Å
R-factor: 0.22
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: KB5-C20 T-Cell receptor alpha-chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAA63396 (0-110)
    Domains in SCOPe 2.02: d1kj2a_
  • Chain 'B':
    Compound: KB5-C20 T-Cell receptor beta-chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB 3114395 (0-115)
    Domains in SCOPe 2.02: d1kj2b_
  • Chain 'D':
    Compound: KB5-C20 T-Cell receptor alpha-chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAA63396 (0-110)
    Domains in SCOPe 2.02: d1kj2d_
  • Chain 'E':
    Compound: KB5-C20 T-Cell receptor beta-chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB 3114395 (0-115)
    Domains in SCOPe 2.02: d1kj2e_
  • Chain 'H':
    Compound: Allogeneic H-2Kb MHC Class I Molecule
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAB17606 (0-End)
    Domains in SCOPe 2.02: d1kj2h1, d1kj2h2
  • Chain 'I':
    Compound: Allogeneic H-2Kb MHC Class I Molecule
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAB17606 (0-276)
    Domains in SCOPe 2.02: d1kj2i1, d1kj2i2
  • Chain 'L':
    Compound: beta-2 microglobulin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1kj2l_
  • Chain 'M':
    Compound: beta-2 microglobulin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1kj2m_
  • Chain 'P':
    Compound: naturally processed octapeptide pkb1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: naturally processed octapeptide pkb1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kj2A (A:)
    qqvrqspqsltvwegetailncsyedstfnyfpwyqqfpgegpallisirsvsdkkedgr
    ftiffnkrekklslhitdsqpgdsatyfcaaryqggralifgtgttvsvsp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kj2B (B:)
    vtlleqnprwrlvprgqavnlrcilknsqypwmswyqqdlqkqlqwlftlrspgdkevks
    lpgadylatrvtdtelrlqvanmsqgrtlyctcsaapdwgasaetlyfgsgtrltvl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kj2D (D:)
    qqvrqspqsltvwegetailncsyedstfnyfpwyqqfpgegpallisirsvsdkkedgr
    ftiffnkrekklslhitdsqpgdsatyfcaaryqggralifgtgttvsvsp
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kj2E (E:)
    vtlleqnprwrlvprgqavnlrcilknsqypwmswyqqdlqkqlqwlftlrspgdkevks
    lpgadylatrvtdtelrlqvanmsqgrtlyctcsaapdwgasaetlyfgsgtrltvl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1kj2H (H:)
    gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
    eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
    cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
    rtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgt
    fqkwasvvvplgkeqyytchvyhqglpepltlrwepp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kj2H (H:)
    gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
    eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
    cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
    rtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgt
    fqkwasvvvplgkeqyytchvyhqglpepltlrwep
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kj2I (I:)
    gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
    eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
    cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
    rtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgt
    fqkwasvvvplgkeqyytchvyhqglpepltlrwepp
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kj2L (L:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kj2M (M:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.