PDB entry 1kil

View 1kil on RCSB PDB site
Description: Three-dimensional structure of the complexin/SNARE complex
Deposited on 2001-12-03, released 2002-03-13
The last revision prior to the SCOP 1.65 freeze date was dated 2002-03-13, with a file datestamp of 2002-03-13.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.245
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1kila_
  • Chain 'B':
    Domains in SCOP 1.65: d1kilb_
  • Chain 'C':
    Domains in SCOP 1.65: d1kilc_
  • Chain 'D':
    Domains in SCOP 1.65: d1kild_
  • Chain 'E':
    Domains in SCOP 1.65: d1kile_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kilA (A:)
    gsnrrlqqtqaqvdevvdimrvnvdkvlerdqklselddradalqagasqfetsaaklkr
    kywwkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kilA (A:)
    snrrlqqtqaqvdevvdimrvnvdkvlerdqklselddradalqagasqfetsaaklkrk
    ywwkn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kilB (B:)
    gsalseietrhseiiklensirelhdmfmdmamlvesqgemidrieynvehavdyverav
    sd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kilB (B:)
    lseietrhseiiklensirelhdmfmdmamlvesqgemidrieynvehavdyveravsd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1kilC (C:)
    gsleemqrradqladeslestrrmlqlveeskdagirtlvmldeqgeqldrveegmnhin
    qdmkeaeknlkdlw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kilC (C:)
    sleemqrradqladeslestrrmlqlveeskdagirtlvmldeqgeqldrveegmnhinq
    dmkeaeknlkdl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kilD (D:)
    gsarenemdenleqvsgiignlrhmaldmgneidtqnrqidrimekadsnktrideanqr
    atkmlw
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1kilE (E:)
    gskdpdaakkeeerqealrqaeeerkakyakmeaerevmrqgirdkygi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kilE (E:)
    kkeeerqealrqaeeerkakyakmeaerevmrqgirdkygi