PDB entry 1kig

View 1kig on RCSB PDB site
Description: bovine factor xa
Deposited on 1997-04-24, released 1998-10-28
The last revision prior to the SCOP 1.55 freeze date was dated 1998-10-28, with a file datestamp of 1998-10-28.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.187
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Domains in SCOP 1.55: d1kigh_
  • Chain 'I':
    Domains in SCOP 1.55: d1kigi_
  • Chain 'L':
    Domains in SCOP 1.55: d1kigl_

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kigH (H:)
    ivggrdcaegecpwqallvneenegfcggtilnefyvltaahclhqakrftvrvgdrnte
    qeegnemahevemtvkhsrfvketydfdiavlrlktpirfrrnvapaclpekdwaeatlm
    tqktgivsgfgrthekgrlsstlkmlevpyvdrstcklsssftitpnmfcagydtqpeda
    cqgdsggphvtrfkdtyfvtgivswgegcarkgkfgvytkvsnflkwidkimkaragaag
    s
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kigI (I:)
    ynrlcikprdwidecdsneggerayfrngkggcdsfwicpedhtgadyyssyrdcfnaci
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kigL (L:)
    csldnggcdqfcreersevrcscahgyvlgddskscvsterfpcgkftqgr